Conserved Protein Domain Family
COX3

?
MTH00189: COX3 
cytochrome c oxidase subunit III; Provisional
Statistics
?
PSSM-Id: 177238
View PSSM: MTH00189
Aligned: 46 rows
Threshold Bit Score: 343.109
Threshold Setting Gi: 242543534
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
157384923   1 MSRVTPFHLVDGSPWPLFGALAGLSMVSWLLGLFHGSggGFMLLLGAISFMVLlCYVWWRDVVREASLLGFHTPGVQVNL 80 
27228451    2 MVRFTPFHLVDGSPWPLLSALGAFGVVGGLMSMMHQH--LFGTLFMYVGLIFLlTILWWRDVDRESSLLGFHTKGVQKNM 79 
28436208    2 MVRFSPFHLVDASPWPILSAFGAFTLVGGLVSMLHQD--VFIVFFFGTGLVFIlAILWWRDVDREASLLGFHTKGVQKNL 79 
57642249    1 MARSTPFHLVDASPWPILSAMSGFLLLSSLCDFMHSS--SYVGILVGAISTIIvTGFWWRDVSREACLGGFHNPPVQISL 78 
242543534   1 -MRNTPFHLVDNSPWPFFGSMAFFFFVSGALFMFKMS--SMSIFFVGVVFIFFlSFFWWRDVVRESLYLGFHTASVQSNL 77 
270267724   1 MFRSTSFHLVDNSPWPIIGAWGFFFITSSFLFMFQKV--GMLVLF-ALMFLVVlAYCWWRDVIRESSLLGFHTKGVHVIF 77 
270267404   2 LVRKNPFHLVDSSPWPIVAGGVALLLTMGLVLWMHSK--TFVFVGGSFFLMVFlVYSWWRDVVREGSYLGFHGVMVQKGL 79 
270267325   1 MLRRHPFHLVDNSPWPLLASLCAFLTMTNFLTLFHGG--KMYMFF--FFLLFLiSFFWWRDVVRESTYLGFHTKLTQKNI 76 
270267458   1 MFRMNPFHLVDASPWPIMGSFGAMFTAFGLVIWFHLG--SLFFMFFGVFLIVFtKYVWWRDVVREASSLGFHLLQVMSGL 78 
7335695     1 MRRSSVFHLVDASPWPILGANVGLMLVLGLVRWFHGG--GFMVVEIGLWLCVGcVFFWWRDVVRESSFLGFHTSGVRRGL 78 
157384923  81 LYGMVWFIVSEVCFFFGFFWTFYYASLNPVVEIGMVWPPVGIVPLDPVGVPLLNTVVLLGSGFTVTWSHYSLLLGEKSGA 160
27228451   80 YSGMIWFIMSEVFFFIGFFWTFFHSGLNSVIDLGMEWPPFGVMVLNPYGVPLLNTAVLISSGITVTCSHYSLLISDFNSC 159
28436208   80 YSGMIWFIMSEIFFFLGFFWTFFHSGLNSVVELGMEWPPMGVLVLNPTGVPLLNTAVLISSGITVTCSHYSLVISNYYSC 159
57642249   79 RMAMIWFICSEVLFFFGFFWTFFHASLGVVAETGYAWPPAGVLVLDPSSVPLLNTVLLLGSSITVTWSHNCLLMGNYMGA 158
242543534  78 LIGMVWFISSEVLFFFGFFWSFFHSSLGVCVDLFSSWPPTGVEVLNPLGVPLLNTLVLLSSGFSVTWAHYSLLLNNYSDA 157
270267724  78 LTGMVWFISSEVLFFFGFFWAFFHSSLCVSVDLVSLWPPIGVEVLNPLGVPLLNTVVLLSSGVTVTWAHYGVFSSNLNNA 157
270267404  80 RIGMMLFIVSEVFFFLGFFWAFFHSSLSVLADISEEWPPVGLEPMDPMGVPLLNTVVLLSSGVTVTYCHYSVLTDSFGGG 159
270267325  77 LNGMMWFISSEVFFFLGFFWAFFHSSLSPSITFGMLWPPVGINVLNPLSVPLLNTVVLLSSGITVTWSHYSIYLSDRAGG 156
270267458  79 RIGMVLFITSEVLFFFGFFWTFFHSGLVPVVELGGVWPPFMLESLDPMAVPLLNTVVLLSSGVSVTYSHYSVINSNLTDG 158
7335695    79 QIGMVLFILSEVFFFLGFFWAFFHSSLVSSSDVGNTWPPYGLEVMDPMAVILLNTVVLLGSGVFVTYSHYSLVMGDYTGS 158
157384923 161 KVGLIYTLGLGIFFTLLQILEYGDSSFSLADSVYGSIFFMATGFHGFHVLVGSVFLGVSLVRMWVGHLGASRHVGYECAI 240
27228451  160 AIWLANTIMLGVLFTGLQYMEYLESSFGMNDSVYGSIFFMATGFHGFHVIIGSIFLFISFLRILGGKLSPSRHVGFECAI 239
28436208  160 AIWLLVTIGLGVFFTGLQYMEYLESSFGMNDSVYGSIFFMATGFHGFHVLIGSMFLFVSFLRILGGKVSGNRHVGFECAI 239
57642249  159 KNGLVFTIALGAVFTAVQYLEYCESGFSISDSAYGSVFFMATGFHGFHVLVGSAFLVVCLVRMVGGQLNASRHVGYECAV 238
242543534 158 LFGMLFTIGLGMFFTLLQAMEYLDGFFLISDSVYGSVFFMATGFHGFHVIVGSLFLLVSSFRMFLGQFNMNHHIGLECSI 237
270267724 158 LKGMIYTMFLGVFFTLLQYMEYLDSSFMISDSVYGSIFFMATGFHGFHVIIGTCFLLVSFLRMWKGHFTSKHHIGLECSI 237
270267404 160 LMGLVWTLALGFFFTLLQLLEYVESSFSIADSVYGSVFFMATGFHGFHVIVGSLFLLVCLLRMGVGHFSSTQHVGLECAI 239
270267325 157 IYGLGYTIFLGFFFTLLQYLEYSECSFTITDSVYGSCFFLATGFHGLHVLVGSIFLLVSLYRMYKGHFTSKQHVGLECSI 236
270267458 159 IMGLVITLFLGFFFTLLQAFEYVQTSFTIADSVYGSIFFMATGFHGFHVFVGSVFLLVCLVRMVNGHVLSNHHIGYECAI 238
7335695   159 VLGLFFTLCLGVFFTLLQLMEYLDASFSIADSVYGSVFFMATGFHGFHVLVGSAFLFVCLFRLVLGEFSSSHHVGYECAI 238
157384923 241 WYWHFVDVVWLFLYVSVYWWGS 262
27228451  240 WYWHFVDVVWIFLYACIYGWGS 261
28436208  240 WYWHFVDVVWIFLFICLYGWGS 261
57642249  239 WYWHFVDTVWIYLYCLVYWWGS 260
242543534 238 WYWHFVDVVWLFLYISIYWWGS 259
270267724 238 WYWHFVDVVWIFLYISIYWWGS 259
270267404 240 WYWHFVDVVWIFLYVSIYWWGS 261
270267325 237 WYWHFVDVVWVFLYLSIYWWGS 258
270267458 239 WYWHFVDVVWIFLYSFVYMWGG 260
7335695   239 WYWHFVDVVWIFLYLSIYWWGS 260
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap