Conserved Protein Domain Family
ND4L

?
MTH00188: ND4L 
NADH dehydrogenase subunit 4L; Provisional
Statistics
?
PSSM-Id: 177237
View PSSM: MTH00188
Aligned: 11 rows
Threshold Bit Score: 48.0469
Threshold Setting Gi: 15341659
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
242610067   5 LEINLGFVSIMLVLSCYVGLFLERGHLLMILLLLEGVMLGLFSFLLFGVgSFILSNFYLVLVLISFGACEAAVGLSLLVS 84 
169794157   2 MIGGMVLVMYFLFFFSVVTFIINGKHLLSLLLALEAIMMGLFCFSVVII-SFLELELFYCLVILTFSACEASIGLSVLVN 80 
169794171   7 LSFWFNISIYCFNFYNCFNFFLNNKHLLSLLLSLEALMMSLFCLAVISM-SPMNVGYYYSLIILTFAACEAAVGLSILVN 85 
190349589   1 ----MTLTPQLLVMIGCASFISKRSHILAILLSLEFIMLNMFWMMNIWL-LIMEKEMFLSVVFLSITACEASIGLAILIS 75 
126506280   2 ILQLKFLIPIMFMIVGVVSFVMFRVHLLSMLLSLEFIMLNIFWVMISWL-VYMGKELFLSLIFLTLTACEASLGLSLLVS 80 
219524278   1 -MLSLISIIAPLPVLTLFTFMLTRKQLLMALLSLEATMLALTLLLAHTS----PSHTLSIITLLTMAACEASVGLAVLVL 75 
228015398   1 MFFSIILLISLFPAWPLITLLLQRKQFLMALLALEVLALSLVMVLLFSS----MKSLFFLLLVLPMAACEASVGLALLVS 76 
15341659    1 ----MLGFCLVVFVVVLVGLLSNSAHYLGFLICLEGLMLSSLMFVLVGT--DFVFDFYMSLSLLVLAACSASLGLALLVC 74 
8404663     1 ------MFSLSFCFLAFSGLLSNRGHYLNLLICLEALMLSAVLVVMVGP---GEYEPYLGLGLLVVGACEASLGLAVLVA 71 
240266401   5 TFFDFFFVGTIVVVISLFTMMIQRIHLLMVLLCLEMIMLGLFFFSCSFF-GYCGGSCYISFVLLSFSACEASVGLSLLAA 83 
299827798   1 -----MLTPMFMVILGCFSFVSKRNHLLTILLNLEFIMLNMFWMMNTWL-LITNKELFMSLMFLTITACEASIGLALLVS 74 
242610067  85 LVRTHGNDFVSSLTIYEC 102
169794157  81 MINSHGSSSLSSLSLIQC 98 
169794171  86 MISSHGSSYVGSMNLMQC 103
190349589  76 MMRSHGNDYYNSLSIIL- 92 
126506280  81 LIRSHGNDMFGSLKDC-- 96 
219524278  76 MTRTAGSDTLTSLNLNKW 93 
228015398  77 STRHFGSDMLSNLTMSKW 94 
15341659   75 LLRSGGTGGVSLGDVG-- 90 
8404663    72 LLRSGGS-----MNLKSC 84 
240266401  84 LIRSHGKDFISLFCGYSC 101
299827798  75 LIRSHGNDYFKSLSIILC 92 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap