Conserved Protein Domain Family
ATP8

?
MTH00186: ATP8 
ATP synthase F0 subunit 8; Provisional
Statistics
?
PSSM-Id: 177236
View PSSM: MTH00186
Aligned: 9 rows
Threshold Bit Score: 40.1089
Threshold Setting Gi: 77020039
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
169794167  1 MPQLSPLNWAFLSIMILTLIFMMKVFFSFMSINKLNFISFGnnKALRKAPKWNW 54 
169794153  1 MPQLSPLNWAFISLIILMLIFLTKVFFSFLTNKKMKFLSNY--VFLKTFQKWNW 52 
15341652   1 MPQLSPMSWFLLYVVCLLFVFGVMSIFWWEGKPRSTAGVK---LMLAKSAMWKW 51 
8404665    1 MPQLSPMGWSGLYVFSILFVLVWSSLVWWDGMYGCSSDEK---LESKKSSVWKW 51 
219524283  1 MPHLAPMSWVLITIMFWTCFLMLISMTWWQQSPKFEFSQKV--MTTTPSPKWSW 52 
5835481    1 MPQLNPDFWALNFVTVWLLLAIALATTTSLQLPLQPSPSSLq-HHTLSTPQWLW 53 
77020039   1 MPQLAPNFWALNFIMIWTLLITITTLTISLPPSNLPSAESRr-PLTPTHPNWPW 53 
289183194  1 MPQLNPDFWALNFITVWLLVAIALATTASLQLPLPPSSSAPhpHHTFSTPQWLW 54 
299827792  1 MPQMKPLMWMLLMMYTGASIFLYMIMIFYFKNKYNLNYNE---KMKLILTNWKW 51 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap