Conserved Protein Domain Family
COX2

?
MTH00185: COX2 
cytochrome c oxidase subunit II; Provisional
Statistics
?
PSSM-Id: 164736
View PSSM: MTH00185
Aligned: 13 rows
Threshold Bit Score: 435.083
Threshold Setting Gi: 299825751
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5836048     1 MAHPSQLGFQDAASPVMEELIHFHDHTLMIVFLISTLVLYIITAMVTTKLTNKYILDSQEIEIVWTILPAIILIMIALPS 80 
5836076     1 MAHPAQLGFQDAASPIMEELLHFHDHTLMIVFLISTLVLYIIVAMVTTKLTNKYILDSQEIEIVWTILPAIILIMIALPS 80 
6691426     1 MAQQAQLGLQDAASPIMEELIHFHDHTLTVVFLISVLIFYLITLMVTTRFTNKHSLDSQEVEIVWTVMPAIVLIMIALPS 80 
5835600     1 MAHPSQLGFQDAASPVMEELIHFHDHTLMIVFLISTLVLYIITAMVSTKLTNKYILDSQEIEIVWTILPAIILIMIALPS 80 
5835712     1 MAHPSQLGFQDAASPVMEELLHFHDHTLMIVFLISTLVLYIIMAMVSTKLTNKYILDSQEIEIVWTILPAVILIMIALPS 80 
5835070     1 MAQQAQLGLQDAASPIMEELIHFHDHTLTVVFLISVLIFYLIIVMVTTTFMNKHSLDSQEVEIVWTVMPAIVLITIALPS 80 
5835223     1 MAHPSQLGLQDAASPVMEELIHFHDHALMIVFLISTLVLYIIVAMVSTKFTNKFILDSQEIEIVWTILPAVILIMIALPS 80 
5835377     1 MAHPSQLGLQDAASPVMEELLHFHDHALMIVFLISTLVFYIILAMMTTKMTDKYILDAQEIEIVWTLLPAIVLILVALPS 80 
18138247    1 MAHPSQLGLQDAASPVMEELLYFHDHTLMIVFLISTLILYVIVAMVSTKLTNKFILESQEIEIIWTILPAVILILIALPS 80 
16117414    1 MAHPSQLGFQDAASPVMEELIHFHDHTLMIVFLISALVLYIITAMVSTKLTNKYILDSQEIEIVWTILPAIILIMIALPS 80 
68989206    1 MAHPSQLGFQDAASPIMEELLHFHDHTLMIVFLISTLVLYIIVAMVTTKLTNKYILDSQEIEIVWTILPAIILIMIALPS 80 
62184400    1 MAHPSQLGLQDAASPVMEELLHFHDHALMIVFLISTLVLYIILAMMTTKMTDKYILDAQEIEIVWTLLPAIVLILVALPS 80 
299825751   1 MAQQAQLGLQDAASPIMEELIHFHDHTLTVVFLISVLIFYLIVLMVSTRFMNKHSLDSQEVEIVWTVLPAIVLIMIALPS 80 
5836048    81 LRILYLMDEINDPHLTIKAMGHQWYWSYEYTDYEDLGFDSYMIQTQDLAPGQFRLLETDHRMVVPMESPIRVLVSAEDVL 160
5836076    81 LRILYLMDEINDPHITIKALGHQWYWSYEYTDYENLEFDSYMIQTEDLYPGQFRLLETDHRMVVPMESPIRVLVTAEDVL 160
6691426    81 LRILYLTDEISDPHLTIKAVGHQWYWSYEYTDYNQIEFDSYMTPTNELEPGGIRLLDVDHRIVVPMESPIRMLITSEDVI 160
5835600    81 LRILYLMDEINDPHLTIKAMGHQWYWSYEYTDYEDLGFDSYMIQTQDLTPGQFRLLETDHRMVVPMESPIRVLVSAEDVL 160
5835712    81 LRILYLMDEINDPHLTIKAMGHQWYWSYEYTDYEDLGFDSYMIQTQDLTPGQFRLLETDHRMVVPMESPIRVLVSAEDVL 160
5835070    81 LRILYLTDEISNPHLTIKAVGHQWYWSYEYTDYHQMEFDSYMIPTNELEPGGIRLLDVDHRIVVPMESPVRMLITSEDVI 160
5835223    81 LRILYLMDEINDPHLTVKAVGHQWYWSYEYSDYETLNFDSYMTPTQDLTPGQFRLLETDYRMVVPMESPIRVLITADDVI 160
5835377    81 LRILYLIDEVENPHLTIKAMGHQWYWSYEYTDYEELSFDSYMTPLQDLNPGQFRLLETDHRMVIPMESLIRVLISAEDVL 160
18138247   81 LRILYLMDEINDPHLTIKAIGHQWYWSYEYSDYETLNFDSYMTPTQDLTSGQFRLLETDHRMVTPMESPIRVLITADDVL 160
16117414   81 LRILYLMDEINDPHLTIKAMGHQWYWSYEYTDYEDLGFDSYMIQTQDLTPGQFRLLETDHRMVVPMESPIRVLVSAEDVL 160
68989206   81 LRILYLMDEINDPHITIKALGHQWYWSYEYTDYENLEFDSYMIQTEDLTPGQFRLLETDHRMVVPMESPIRVLVTAEDVL 160
62184400   81 LRILYLIDEVENPHLTIKAMGHQWYWSYEYTDYEELSFDSYMTPPQDLNPGQFRLLETDHRMVIPMESLIRVLISAEDVL 160
299825751  81 LRILYLTDEISDPHLTIKAVGHQWYWSYEYTDYNQMEFDSYMTPTNELEPGGIRLLDVDHRIVVPMESPIRMLITSEDVI 160
5836048   161 HSWAVPALGVKMDAVPGRLNQTAFIISRPGVYYGQCSEICGANHSFMPIVVEAIPLEHFEAWSSSMLEEA 230
5836076   161 HSWTIPALGVKMDAVPGRLNQTAFIISRPGVYYGQCSEICGANHSFMPIVVEAVPLEHFENWSSLMLEEV 230
6691426   161 HSWTIPSLGTKVDAVPGRLNQATFITIRPGLYFGQCSEICGANHSFMPIALEAVPLSYFESWTTDVLES- 229
5835600   161 HAWAVPALGVKMDAVPGRLNQTAFIISRPGVYYGQCSEICGANHSFMPIVVEAVPLEHFETWSSLMLEEA 230
5835712   161 HSWTVPALGVKMDAVPGRLNQTAFIISRPGVYYGQCSEICGANHSFMPIVVEAVPLEHFESWSSLMLEEA 230
5835070   161 HSWTIPSLGTKVDAVPGRLNQATFITTRPGLFFGQCSEICGANHSFMPIALEAVPLSNFENWTTKVLAS- 229
5835223   161 HSWAVPALGIKMDAVPGRLNQASFITARPGMFYGQCSEIWGANHSFMPIVVEAAPLQHFENWSSLMLEKA 230
5835377   161 HSWAVPALGVKMDAVPGRLNQITFMISRPGLYYGQCSEICGANHSFMPIVLEAIPLDPFEDWSSSMLEEA 230
18138247  161 HAWAVPALGIKMDAVPGRLNQASFTTTRPGVFYGQCSEICGANHSFMPIVVEAVPLQQFENWSSLMLEEA 230
16117414  161 HSWTVPALGVKMDAVPGRLNQTAFIISRPGVYYGQCSEICGANHSFMPIVVEAVPLEHFETWSSLMLEEA 230
68989206  161 HAWTIPALGVKMDAVPGRLNQTAFIISRPGIYYGQCSEICGANHSFMPIVVEAVPLEHFENWSSLMLEET 230
62184400  161 HSWAVPALGVKMDAVPGRLNQITFMVSRPGLYYGQCSEICGANHSFMPIVLEAIPLDPFEDWSSLMLEEA 230
299825751 161 HSWTIPSLGTKVDAVPGRLNQATFITIRPGLYFGQCSEICGANHSFMPIALEAVPLSYFESWTTAGV--- 227
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap