Conserved Protein Domain Family
COX1

?
MTH00184: COX1 
cytochrome c oxidase subunit I; Provisional
Statistics
?
PSSM-Id: 177235
View PSSM: MTH00184
Aligned: 19 rows
Threshold Bit Score: 830.239
Threshold Setting Gi: 164421160
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
164421020   1 MFEWLIRWVFSTNHKDIGTLYLLFGAFAGMIGTAFSMLIRLELSAPGSMLGDDHLYNVIVTAHAFVMIFFLVMPVMIGGF 80 
164420981   1 MSLYLSXWLFSTNHKDIGTLYLVFGAFAGMIGTALSMLIRLELSAPGSMLGDDHLYNVIVTAHAFVMIFFLVMPVMIGGF 80 
164421144   1 MSLYLSRWLFSTNHKDIGTLYLVFGAFAGMIGTALSMLIRLELSAPGSMLGDDHLYNVIVTAHAFVMIFFLVMPVMIGGF 80 
164421033   1 MSLYLSRWLFSTNHKDIGTLYLLFGVFAGMIGTAFSMLIRLELSAPGSMLGDDHLYNVIVTAHAFVMIFFLVMPVMIGGF 80 
164421190  12 SSPWITRWLFSTNHKDIGTLYLLFGIVGGMVGLSLSLIMRFELSSPGTLLGDDNIYNVVVTAHGLIMVFFLVMPVLIGGF 91 
164421160  12 SSPWITRWLFSTNHKDIGTLYLLFGIVGGTVGLSLSLIMRFELSSPGTLLGDDNIYNVVVTAHGLIMVFFLVMPVLIGGF 91 
164421184   1 MNLYLSRWLFSTNHKDIGTLYLLFGAFAGMIGTAFSMLIRLELSAPGSMLGDDHLYNVIVTAHAFVMIFFLVMPVMIGGF 80 
164421139   1 MNLYLSRWLFSTNHKDIGTLYLLFGAFAGMIGTAFSMLIRLELSAPGSMLGDDHLYNVIVTAHAFVMIFFLVMPVMIGGF 80 
164421124   2 DRLYLTRWLYSTNHKDIGTLYLLFGVFSGMIGSGFSLLIRLELSAPGSMLGDDQLYNVMVTAHGLIMVFFLVMPVMIGGF 81 
63025108    1 -MLYLTRWLYSTNHKDIGTLYLLFGAFSGMIGTGFSFLIRLELSAPGSMLGDDHLYNVIITAHGLIMIFFLVMPVMIGGF 79 
164421020  81 GNWFVPLYIGAPDMAFPRLNNISFWLLPPALSLLLASVFVEQGAGTGWTVYPPLSGIQAHSGGSVDLVIFSLHLAGISSI 160
164420981  81 GNWLVPLYIGAPDMAFPRLNNISFWLLPPALTLLLGSAFVEQGAGTGWTVYPPLAGIQTHSGGSVDMAIFSLHLAGISSI 160
164421144  81 GNWLVPLYIGAPDMAFPRLNNISFWLLPPALTLLLGSAFVEQGAGTGWTVYPPLAGIQTHSGGSVDMAIFSLHLAGISSI 160
164421033  81 GNWLVPLYIGAPDMAFPRLNNISFWLLPPALILLLGSAFIEQGAGTGWTVYPPLSSIQTHSGGSVDMAIFSLHLAGISSI 160
164421190  92 GNWXVPLYIGSPDMAFPRLNNLSFWLLPPAFIMLVGSVFVEEGAGTGWTLYPPLSGGMGHSGPSVDMAIFSLHLAGISSI 171
164421160  92 GNWFVPLYIGSPDMAFPRLNNLSFWLLPPAFIMLAGSVFVEEGAGTGWTLYPPLSGGMGHSGPSVDMAIFSLHLAGISSI 171
164421184  81 GNWFVPLYIGAPDMAFPRLNNISFWVLPPALTLLLGSAFIEQGAGTGWTVYPPLSAIQAHSGGSVDMAIFSLHLAGISSI 160
164421139  81 GNWFVPLYIGAPDMAFPRLNNISFWVLPPALTLLLGSAFVEQGAGTGWTVYPPLAAIQAHSGGSVDMAIFSLHLAGISSI 160
164421124  82 GNWLVPLYIGAPDMAFPRLNNISFWVLPPSAILLLGSAFVEQGVGTGWTLYPPLSSIQAHSGGSVDAAIFSIHLAGISSI 161
63025108   80 GNWFVPLYIGAPDMAFPRLNNISFWVLPPSLILLLGSAFVEQGVGAGWTVYPPLSSVQAHSGGSVDAAIFSLHLAGISSI 159
164421020 161 LGAMNFITTIINMRAPGITMDRMPLFVWSILVTAVLLLLSLPVLAGAITMLLTDRNFNTAFFDPAGGGDPILYQHLFWFF 240
164420981 161 LSSMNFITTIINMRAPGMTMDRLPLFVWSILITTILLLLSLPVLAGAITMLLTDRNFNTTFFDPAGGGDPILYQHLFWFF 240
164421144 161 LSSMNFITTIINMRAPGMTMDRLPLFVWSILITTILLLLSLPVLAGAITMLLTDRNFNTTFFDPAGGGDPILYQHLFWFF 240
164421033 161 LSSINFITTILNMRAPGMTMDRLPLFVWSILLTTILLVLALPVLAGAITMLLTDRNFNTTFFDPAGGGDPILYQHLFWFF 240
164421190 172 LGAINFISTIFNMRASGVGWTRMPLFVWSILVTVFLLLLSLPVLAGGITMLLTDRNFNTSFFDPVGGGDPILFQHLFWFF 251
164421160 172 LGAINFISTIFNMRASGVGWTRMPLFVWSILVTVFLLLLSLPVLAGGITMLLTDRNFNTSFFDPVGGGDPILFQHLFWFF 251
164421184 161 LGSINFITTILNMRAPGISMDKMPLFVWSILITTVLLLLALPVLAGAITMLLTDRNFNTTFFDPAGGGDPILYQHLFWFF 240
164421139 161 LGSINFITTILNMRAPGISMDKMPLFVWSILVTTVLLLLALPVLAGAITMLLTDRNFNTTFFDPAGGGDPILYQHLFWFF 240
164421124 162 LGSMNFITTIFNMRAPGITMDRLPLFVWSILVTTYLLLLALPVLAGAITMLLTDRNFNTTFFDPAGGGDPILFQHLFWFF 241
63025108  160 LGSMNFITTIFNMRAPGITMDRLPLFVWSILVTTYLLILSLPVLAGAITMLLTDRNFNTTFFDPAGGGDPILFQHLFWFF 239
164421020 241 GHPEVYILILPGFGMISQIIPTFAAKKQIFGYLGMVYAMVSIGVLGFIVWAHHMFTVGMDVDTRAYFTAATMIIAVPTGI 320
164420981 241 GHPEVYVLILPGFGMVSQIVPTFSAKKQIFGYLGMVYAMLSIGFLGFIVWAHHMFTVGMDVDTRAYFTAATMIIAVPTGI 320
164421144 241 GHPEVYVLILPGFGMISQIVPTFAAKKQIFGYLGMVYAMLSIGFLGFIVWAHHMFTVGMDVDTRAYFTAATMIIAVPTGI 320
164421033 241 GHPEVYILILPGFGIVSQIVPTFAAKKQIFGYLGMVYAMASIGILGFIVWAHHMFTVGMDVDTRAYFTAATMIIAVPTGI 320
164421190 252 GHPEVYVLILPGFGIVSQVIVVFS-KKQIFGYLGMVYAMVSIGVLGFIVWAHHMFTVGMDVDTRAYFTAATMIIAVPTGI 330
164421160 252 GHPEVYVLILPGFGIVSQVIVVFS-KKQIFGYLGMVYAMVSIGILGFIVWAHHMFTVGMDVDTRAYFTAATMIIAIPTGI 330
164421184 241 GHPEVYILILPGFGIISQIIPTFSAKKQIFGYLGMVYAMVSIGILGFIVWAHHMFTVGMDVDTRAYFTAATMIIAVPTGI 320
164421139 241 GHPEVYILILPGFGIISQIIPTFSAKKQIFGYLGMVYAMVSIGILGFIVWAHHMFTVGMDVDTRAYFTAATMIIAVPTGI 320
164421124 242 GHPEVYVLILPGFGIISQIIPTFAAKKQIFGYLGMVYAMVSIGILGFIVWAHHMFTVGMDADSRAYFSAATMIIAVPTGI 321
63025108  240 GHPEVYILILPGFGIVSQIIPTFAAKKQIFGYLGMVYAMVSIGILGFIVWAHHMFTVGMDVDSRAYFSAATMIIAVPTGI 319
164421020 321 KIFSWVATMVGGALRLDTPLLWAIGFVFLFTMGGLTGIVLANSALDVVLHDTYYVVAHFHYVLSMGAIFAIFGGFYYWFG 400
164420981 321 KIFSWIATIFGGSIRLDTPMLWAVGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAIFAIFGGFYYWFG 400
164421144 321 KIFSWIATIFGGSIRLDTPMLWAIGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAIFAIFGGFYYWFG 400
164421033 321 KIFSWIATIFGGYIRLDTPMLWAIGFIFLFTIGGLTGIVLANSSLDVVLHDTYYVVAHFHYVLSMGAIFAIFGGFYYWFG 400
164421190 331 KIFSWIMTAMGGEIVFDTPMLWVAGFVFLFTMGGLTGIVLANSSLDVVLHDTYYVVAHFHYVLSMGAVFSIFAGTYFWFG 410
164421160 331 KIFSWIMTAMGGELVFDTPMLWVAGFVFLFTMGGLTGIVLANSSLDVVLHDTYYVVAHFHYVLSMGAVFSIFAGTYFWFG 410
164421184 321 KIFSWIATMFGGSLRLDTPMLWAIGFVFLFTMGGLTGIVLANSSLDVVLHDTYYVVAHFHYVLSMGAIFAIFGGFYYWFG 400
164421139 321 KIFSWMATMFGGSLRLDTPMLWAIGFVFLFTMGGLTGIVLANSSLDVVLHDTYYVVAHFHYVLSMGAIFAIFGGFYYWFG 400
164421124 322 KIFSWIATIVGGSLRTDTPMLWAMGFVFLFTVGGLTGIVVACSSLDILLHDTYYVVAHFHYVLSMGAIFAIFGGVYYWFG 401
63025108  320 KIFSWIATVVGGSLRTDTPMLWALGFVFLFTVGGLTGIVLACSSLDVLLHDTYYVVAHFHYVLSMGAVFALFGGFYYWFG 399
164421020 401 KITGYCYNEVYGKIHFWLMFIGVNLTFFPQHFLGLAGLPRRYSDFHDSFAGWNQLSSLGSVISILGXIWFIYIVWDAYYC 480
164420981 401 KITGYCYNEGYGRIHFWLMFIGVNLTFFPQHFLGLAGFPRRYSDYADSFAGWNQISSLGSIISIVAVIWFLYIIYDAYCQ 480
164421144 401 KITGYCYNEVYGRIHFWLMFVGVNLTFFPQHFLGLAGFPRRYSDYADSFAGWNQISSLGSIISIVAVIWFLYIIYDAYCQ 480
164421033 401 KISGYCYNEIYGKIHFWLMFIGVNLTFFPQHFLGLAGFPRRYSDYADSFAGWNQVSSLGSVISIIAIVWFLYILYDTYCQ 480
164421190 411 KITGFQYNELLGRVHFWLMFIGVNLTFFPQHFLGLAGMPRRYSDFPDCFAGWNLISSFGSVISLVSIMVFFYMVYDALKK 490
164421160 411 KITGYQYNELLGRVHFWLMFIGVNLTFFPQHFLGLAGMPRRYSDFPDCFAGWNMVSSFGSVISLVSIMVFFYMVYDALRR 490
164421184 401 KITGYCYNEFYGKIHFWIMFVGVNLTFFPQHFLGLAGLPRRYSDFHDSFYGWNQLSSIGSIISIVGVVWFIFIIYNAYVK 480
164421139 401 KITGYCYNEFYGKIHFWIMFLGVNLTFFPQHFLGLAGLPRRYSDFHDSFYGWNQISSVGSIISILGVVWFIYIIYNAYLN 480
164421124 402 KITGYCYNEVLGKIHFWLMFIGVNLTFFPQHFLGLAGLPRRYSDYHDSFAGWNQISSLGSFISIVSVMVFLYLVYDAYVW 481
63025108  400 KITGYCYNEVLGKIHFWLMFIGVNITFFPQHFLGLAGLPRRYSDYHDSFAGWNQISSVGSLISIVSVMVFLYLVYDAYVR 479
164421020 481 EIPFTGWAEESEMsrltgviSSSLEWVQDSPPAPHTYNELPLVLKR 526
164420981 481 EVKFVGWMEETGH-------HVSLEWIQTSPPAHHTYNELPYVSRY 519
164421144 481 EIKXVGWMEDSGH-------HISLEWIQTSPPAHHTYNELPYVSRY 519
164421033 481 EVKFVGWMENSGH-------QASLEWIHDSPPAHHTYNELPFVCIF 519
164421190 491 QVLFRGWGDG----------METLEWVQVSPPEWHTYLEAPYVWKI 526
164421160 491 QILFRGWGDG----------VETLEWAQVSPPEWHTYSEAPYVWKK 526
164421184 481 QNKFEGWVEDTGY-------YHSLEWSHVSPPAHHTYNELPYVFKK 519
164421139 481 QIKFEGWVENMGH-------HLSLEWAHSSPPAHHTYNELPYVSKK 519
164421124 482 EIKFVGWTKDSGH-------YPSLEWSQTSPPAHHTYNELPFVYKG 520
63025108  480 EIKFVGWTNDSGH-------YPSLEWVQASPPAHHTYNELPFVYKI 518
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap