Conserved Protein Domain Family
COX1

?
MTH00183: COX1 
cytochrome c oxidase subunit I; Provisional
Statistics
?
PSSM-Id: 177234
View PSSM: MTH00183
Aligned: 480 rows
Threshold Bit Score: 893.124
Threshold Setting Gi: 5835320
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
124486572   1 MAITRWFFSTNHKDIGTLYLVFGAWAGMVGTALSLLIRAELSQPGALLGDDQIYNVIVTAHAFVMIFFMVMPLMIGGFGN 80 
157736134   1 MAITRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELNQPGSLLGDDQIYNVIVTAHAFVMIFFMVMPAMIGGFGN 80 
218157290   1 MTITRWFFSTNHKDIGTLYLIFGAWAGMVGTALSLLIRAELSQPGSLLGDDQIFNVIVTAHAFVMIFFMVMPVMIGGFGN 80 
283767180   1 MAITRWFFSTNHKDIGTLYLVFGAWAGMVGTALSLLIRAELSQPGSLLGDDQIYNVIVTAHAFVMIFFLVMPVMIGGFGN 80 
283767194   1 MAITRWFFSTNHKDIGTLYLVFGAWAGMVGTALSLLIRAELSQPGSLLGDDQIYNVIVTAHAFVMIFFLVMPVMIGGFGN 80 
283767208   1 MAITRWFFSTNHKDIGTLYLVFGAWAGMVGTALSLLIRAELSQPGSLLGDDQIYNVIVTAHAFVMIFFLVMPVMIGGFGN 80 
284178612   1 MTITRWFFSTNHKDIGTLYLIFGAWAGMVGTGLSLIIRAELSQPGSLLGDDQIFNVVVTAHAFVMIFFMVMPVMIGGFGN 80 
299823664   1 MTITRWFFSTNHKDIGTLYLIFGAWAGMVGTGLSLIIRAELSQPGSLLGDDQIFNVVVTAHAFVMIFFMVMPVMIGGFGN 80 
301353437   1 MTITRWLFSTNHKDIRPLYLIFGAWAGMVGTALSLLIRAELSQPGSLLGDDQIFNVIVTAHAFVMIFFMVMPVMIGGFGN 80 
55376096    1 MAITRWFFSTNHKDIGTLYLVFGAWSGMVGTALSLLIRAELSQPGSLLGDDQVYNVIVTAHAFIMIFFLVMPVMIGGFGN 80 
124486572  81 WLIPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSGVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGISSILG 160
157736134  81 WLVPLMIGAPDMAFPRMNNMSFWLLPPSLLLLLASAGVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGISSILG 160
218157290  81 WLVPLMIGAPDMAFPRMNNMSFWLIPPSFLLLLASSGVEAGAGTGWTVYPPLAGNLAHAGPSVDLAIFSLHLAGVSSILG 160
283767180  81 WLIPLMIGAPDMAFPRMNNMSFWLLPPSLLLLLSSSAVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILG 160
283767194  81 WLIPLMIGAPDMAFPRMNNMSFWLLPPSLLLLLSSSAVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILG 160
283767208  81 WLIPLMIGAPDMAFPRMNNMSFWLLPPSLLLLLSSSAVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILG 160
284178612  81 WLVPLMIGAPDMAFPRMNNMSFWLIPPAFIMLAASSAVEAGAGTGWTVYPPLAGNLAHAGASVDLAIFALHLAGVSSILG 160
299823664  81 WLVPLMIGAPDMAFPRMNNMSFWLIPPAFIMLAASSAVEAGAGTGWTVYPPLAGNLAHAGASVDLAIFALHLAGVSSILG 160
301353437  81 WLVPLMIGAPDMAFPRMNNMSFWLIPPSFLLLLTSSGVEAGAGTGWTVYPPLAGNLAHAGASVDLAIFSLHLAGVSSILG 160
55376096   81 WLIPLMIGAPDMAFPRMNNMSFWLLPPSLLLLLSSSAVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILG 160
124486572 161 AINFITTIINMKPPAISQYQTPLFVWAVLITAVLLLLSLPVLAAGITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFGH 240
157736134 161 AINFITTIINMKPPATSQYQTPLFVWAVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGH 240
218157290 161 AINFITTIINMKPPGITQYQTPLFVWAVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPSGGGDPILYQHLFWFFGH 240
283767180 161 AINFITTIINMKPAGVSQYQTPLFVWAVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPGGGGDPILYQHLFWFFGH 240
283767194 161 AINFITTIINMKPAGVSQYQTPLFVWAVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPGGGGDPILYQHLFWFFGH 240
283767208 161 AINFITTIINMKPAGVSQYQTPLFVWAVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPGGGGDPILYQHLFWFFGH 240
284178612 161 AINFITTILNMKPPGMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPSGGGDPILYQHLFWFFGH 240
299823664 161 AINFITTILNMKPPGMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPSGGGDPILYQHLFWFFGH 240
301353437 161 AINFITTIINMKPPAISQYQTPLFVWAVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGH 240
55376096  161 AINFITTIINMKPAGISQYQTPLFVWAVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPGGGGDPILYQHLFWFFGH 240
124486572 241 PEVYILILPGFGMISHIVAYYSGKKEPFGYMGMVWAMMAIGLLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKV 320
157736134 241 PEVYILILPGFGMISHIVAYYSGKKEPFGYMGMVWAMMAIGLLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKV 320
218157290 241 PEVYILILPGFGMVSHIVAYYAGKKEPFGYMGMVWAMMAIGLLGFIVWAHHMFTVGMDVDTRAYFTSATMVIAIPTGVKV 320
283767180 241 PEVYILILPGFGMISHIVAYYAGKKEPFGYMGMVWAMMAIGLLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKV 320
283767194 241 PEVYILILPGFGMISHIVAYYAGKKEPFGYMGMVWAMMAIGLLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKV 320
283767208 241 PEVYILILPGFGMISHIVAYYAGKKEPFGYMGMVWAMMAIGLLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKV 320
284178612 241 PEVYILILPGFGMVSHIVAYYAGKKEPFGYMGMVWAMMAIGLLGFIVWAHHMFTVGMDVDTRAYFTSATMVIAIPTGVKV 320
299823664 241 PEVYILILPGFGMVSHIVAYYAGKKEPFGYMGMVWAMMAIGLLGFIVWAHHMFTVGMDVDTRAYFTSATMVIAIPTGVKV 320
301353437 241 PEVYILILPGFGMVSHIVAYYAGKKEPFGYMGMVWAMMAIGLLGFIVWAHHMFTVGMDVDTRAYFTSATMVIAIPTGVKV 320
55376096  241 PEVYILILPGFGMISHIVAYYAGKKEPFGYMGMVWAMMAIGLLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKV 320
124486572 321 FSWLATLHGGSIKWETPLLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMAAFVHWFPLF 400
157736134 321 FSWLATLHGANIKWEAPLLWALGFIFLFTVGGLTGIILANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIIAGFVHWFPLF 400
218157290 321 FSWLATLHGGDLKWEAPLLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLF 400
283767180 321 FSWLATLHGGDLKWDAPFLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAILGGFVHWFPLF 400
283767194 321 FSWLATLHGGDLKWDAPFLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAILGGFVHWFPLF 400
283767208 321 FSWLATLHGGDLKWDAPFLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAILGGFVHWFPLF 400
284178612 321 FSWLATLHGGDLKWEAPLLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFFHWFPLF 400
299823664 321 FSWLATLHGGDLKWEAPLLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFFHWFPLF 400
301353437 321 FSWLATLHGGALKWEAPLLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLF 400
55376096  321 FSWLATLHGGDLKWDAPFLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAILGGFVHWFPLF 400
124486572 401 TGYTLHDTWTKIHFGVMFVGVNLTFFPQHFLGLAGMPRRYSDYPDAYTLWNTVSSIGSLISLMAVIMFLFILWEAFAAKR 480
157736134 401 TGYTLHKTWTKIHFGLMFTGVNLTFFPQHFLGLAGMPRRYSDYPDAYTLWNSISSMGSLVSLLAVSLFMFIIWEAFSTKR 480
218157290 401 TGYTLHSTWTKAHFTIMFMGVNITFFPQHFLGLAGMPRRYSDYPDGYALWNTISSLGSLLSLVAVIILLFIIWEAFAAKR 480
283767180 401 TGYTLHETWTKIHFWVMFAGVNVTFFPRHLLGLAGMPRRYSDYPDAYTLWNTVSSIGSLISLVAVIVFLYILWEAFVSKR 480
283767194 401 TGYTLHETWTKIHFWVMFAGVNVTFFPRHFLGLAGMPRRYSDYPDAYTLWNTVSSIGPLISLVAVVVFLYILWEAFVSKR 480
283767208 401 TGYTLHETWTKIHFWVMFAGVNVTFFPQHFLGLAGMPRRYSDYPDAYTLWNTVSSIGSLISLVAVVVFLYILWEAFVSKR 480
284178612 401 TGYTLHSTWAKAQFATMFAGVNITFFPQHFLGLAGMPRRYSDYPDAYAMWNTISSLGSLVSLSAVIILLFIIWEAFASKR 480
299823664 401 TGYTLHSTWAKAQFATMFAGVNITFFPQHFLGLAGMPRRYSDYPDAYAMWNTISSLGSLVSLSAVIILLFIIWEAFASKR 480
301353437 401 TGYTLHSTWSKAHFAIMFTGVNLTFFPQHFLGLAGMPRRYSDYPDGYALWNTISSLGSLISLVAVILLLFIIWEAFAAKR 480
55376096  401 TGYTLHETWTKIHFWVMFAGVNVTFFPQHFLGLAGMPRRYSDYPDAYTLWNTVSSIGSLISLVAVVVFLYILWEAFVSKR 480
124486572 481 EVMAVEMTMTNVEWLHGCPPPYHTFEEPAFVQIQTR 516
157736134 481 EVLSVEHTVTNVEWLHGCPPPYHTFEEPAFVQVQSR 516
218157290 481 EVLEVRFTSTNVEWLHGCPPPYHTFEEPPFVQVQEG 516
283767180 481 EVQSVELAEYNLEWLHGCPPPYHTFEEPAFVMVQSN 516
283767194 481 EVQSVELAEYNLEWLHGCPPPYHTFEEPAFVMVQSN 516
283767208 481 EVQSVELAEYNLEWLHGCPPPYHTFEEPAFVMVQSN 516
284178612 481 EVLKVDFTSTNVEWIHGCPPPYHTFEEPAFVQVNRM 516
299823664 481 EVLKVDFTSTNVEWIHGCPPPYHTFEEPAFVQVNRM 516
301353437 481 EVLEVRFTTTNVEWLHGCPPPYHTFEEPPFVQLQEA 516
55376096  481 EVQSVELAEYNLEWLHGCPPPYHTFEEPAFVMVQTN 516
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap