Conserved Protein Domain Family
ND4L

?
MTH00180: ND4L 
NADH dehydrogenase subunit 4L; Provisional
Statistics
?
PSSM-Id: 177231
View PSSM: MTH00180
Aligned: 26 rows
Threshold Bit Score: 76.9945
Threshold Setting Gi: 281428838
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
63025107    1 MFYEHVAIGAVLFVLGGLGVVFNRSNLIIMLMSIELMLLAISFLFLINSVIVDDLIGQIFAIMIITVAAAESAIGLAVLV 80 
124484816   1 -MSVIYIGAILIFAIGVLGVILNRNSFIIMLMSMELMYLGVVLLMVLITSAFDDMTGVIWAIAIITVVAADSAIGLSMLV 79 
163854296   1 MDYKYTRVGVILLILGVLGVVLNRKNLIIMLMSIELMLLAVSFLFLKISKVIDNIIGQIFTLMILTVAAAESAIGLAIFV 80 
164421019   1 MNYKYTRVGVILLILGVLGVVLNRKNLIIMLMSIELMLLAVSFLFLKISKVIDNIVGQICTLMILTVAAAESAIGLAIFV 80 
164421196   1 -MRVLVYVGICLFNGGVVGIIVSRGSLIRVLMCLELLLLSVSLLIVNWGVTGDSIEGGILFIMILLIAGAESSLGLGILV 79 
164421123   1 MFYEHVAIGAVLFVLGGLGVVFNRSNLIIMLMSIELMLLAISFLFLINSVIVDDLIGQIFAIMIITVAAAESAIGLAVLV 80 
164421174   1 MYLEYLIIAIVLFILGVLGIVLNRSNLIIMLMSIELMLLAISLLFVINSILIDNLVGQIFTLMILTVAAAESAIGLAILV 80 
164421046   1 MYNEYFVTAVTLFILAVLGIILNRSNVIIMLMSIELMLLAMSFLFLINSEALDNLIGEVFTIMVLTVAAGEIAIGLAILV 80 
164421026   1 MYYEYLTIGVILFILGVLGIVLNRSNIIIMLMCIELMLLAISFLFLINSIAIDNITGQIFTIMILTIAAAESAIGLAILV 80 
164421211   1 ---MCTVTGIVLFILGVWGIILNKSNLMIILMSIELMLLAVSLLFTINSVYLENIIGQIFVIMIIAIAAAESSIGLAILI 77 
63025107   81 AYYRVRGTIVVRSLNLLRG 99 
124484816  80 AFYVTRGSINVKSLNVLRG 98 
163854296  81 AYYRIRGTIGVSSLNLLRG 99 
164421019  81 AYYRIRGTIAVRSLNLLRG 99 
164421196  80 LYHRIRGIVGVRVLSVIRG 98 
164421123  81 AYYRVRGTIVVRSLNLLRG 99 
164421174  81 AYYRIRGTISIKSLNLLRG 99 
164421046  81 AYYRIKGTIAIKSLNLLRG 99 
164421026  81 AYYRIRGTIAIKTLNLLRG 99 
164421211  78 AYYRLRGTIAVKSLNFLKG 96 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap