Conserved Protein Domain Family
ATP6

?
MTH00175: ATP6 
ATP synthase F0 subunit 6; Provisional
Statistics
?
PSSM-Id: 177228
View PSSM: MTH00175
Aligned: 27 rows
Threshold Bit Score: 260.324
Threshold Setting Gi: 281428841
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
164421054   1 MLAAYFDQFNVVNLITIwTAtFSGGYLtFSFTNSALMMVFIVLLFWGGLKV--------NYVIPNRWQSILELINTIIQS 72 
164421199   1 MVVSFFDQFNIIVVLGV--------------SNFSIMLVLIIMMFLIFFEGtgrgliycKRVTGFRW------LLASVRG 60 
164421151   1 MLAAYFDQFNVIRLVTI-QA-FHEDWL-ITFTNSSMMMVLAIIMFWLLLKG--------DELIPRRWQAIMELIYLNIRS 69 
164421169   1 MVVSFFDQFNIIVGLGV--------------SNFSIMLVFIIMMFLIFFEGvgrgliycKRVAGFRW------LLASVRG 60 
164421036   1 MLAAYFDQFNIIRLITI-QA-LFEDWP-ITFTNSSMMMVIAIMAILLLLKG--------DWLIPRRWQILMEIIYLNIRS 69 
164421177   1 MLSEFFDQFNIVSLVSI-PV-FFGNWL-ITFTNSSLMMTSVIIFLSLFFFN--------NKLIPNRWQSIMELIYVNIRY 69 
164421132   1 MLVEYFDQFNIVSLLSV-PI-YWGEWL-IIFTNSSLMMGFVIVILWLLFIN--------NKLIPTRWQLIIELVYENIRL 69 
281428841   1 MVVSFFDQFNIIVVLGV--------------SNFSIMLVFIIMMFLVFFEGmgrgliycKRVTGFRW------LLASVRG 60 
124484823   1 MIATYFDQFNIVSLVG-------------PFTNSWMMMMGALIVILLFLIG--------KRVIPNVWQSIMELAYANIRG 59 
164421212   1 MXVAYFDQFNIISLLMI----SYENSI-ISMTNMSIMAIGVVIILWLFLKE--------KRLIPGXLQIIIEQVTKNIYS 67 
164421054  73 MIKENLGAQGKHYFSFVFCLFIFIGLLNILGLFPYVFTPTTHIIITFGLSFSIVLGVTILGILRFKIDFMSMFMPGGVLL 152
164421199  61 MVIDSFGGNGEXYYPFIVSLFVFLLIINIWGLCPYIFTPTAHVGLTVGFSFTIIVAVTIRGALKFGWGFLSMFMPMGAPM 140
164421151  70 VVRDNLGASGDKYFPFVISLFIFIAMLNTLGLFPYVFTPTVHIVITFGLSFSILIGVTLLGVLTFKWNFLSMFMPSGAPL 149
164421169  61 MVIDSFGGSGERYYPFIVSLFVFLLIINIWGLCPYIFTPTAHVGLTVGFSFTIIVAVTIRGALKFGWGFLSMFMPMGAPM 140
164421036  70 VVRDNLGAPGEKYFPLVLSLFLYIGMLNILGLFPYIFTPTVHIVITFGLSLSILIGVILLGIIKFKWNFLSIFMPGGAPL 149
164421177  70 TVHDNLRFVGQKYFPFIISIFLFIAIMNILGLFPFVFTPTAHIIITFGMSFSIIIAIIISGFITFKLNFLSILMPGGVPI 149
164421132  70 IVHENLGKSGQKYFPFILCIFLFIATMNVLGLFPFIFTPTAHIIVTFGLSLSIILAVTLSGFLTFKLSFFSIFMPGGVPI 149
281428841  61 MVIDSFGGSGERYYPFIVSLFMFLLIINIWGLCPYIFTPTAHVGLTVGFSFTIIVAVTIRGALKFGWGFLSMFMPMGAPM 140
124484823  60 MVYDNLGKPGQKYFPFILSLFMFIVVLNGLGVFPYVFTPTVHIIITFGMSLSIIIGVTLLGFWGFGGNFLSILMPAGAPM 139
164421212  68 LIKENLGNQGNGYFFXILGLFLFIGALNYISLFPYVXSVTAHIIVTFGLSFSILIGTTLLGGIKFKWNFFGILMPGGAPL 147
164421054 153 MLAPFLVIIETISYVTRAISLGLRLAANISAGHLLFAIFSGFVFDMLTNGLIILSLFPVLVMIFITILEMAVAVIQAYVF 232
164421199 141 GLSLGLVIIESVSYLIRIISLGVRLAANITAGHLLLAIISGFVWEMVMNEWLFLGLGCSLILILVVVLEVGVALIQAYVF 220
164421151 150 VLAPLLVYIETLSYISRALSLGLRLAANLTAGHLLFAIMSGFTFNMLANGLIFTSLFPVLIMLFVTILEMAVAVIQAYVF 229
164421169 141 GLSLGLVVIESVSYLIRIISLGVRLAANITAGHLLLAIISGFVWEMVINEWLFLGLGCSLILILVVVLEVGVALIQAYVF 220
164421036 150 ALAFILVPIETLSYLSRALSLGLRLAANLTAGHLLFAIISGFTFTMLANGLFVLSLFPMLVMLFITILEMAVAIIQAYVF 229
164421177 150 FLAPFLVVIETLSFMIRAISLGVRLAANISAGHLLFAILSGFAFNMFINGLMFLSIFPLLIMIFITLLEIMVAVIQAYVF 229
164421132 150 FLAPFLVVIETISFMIRAISLGVRLAANISAGHLLFAILSGFAFNMLLNGLIFLSSFPLLIMIFITLLEIMVAVIQAYVF 229
281428841 141 GLSLGLVIIESVSYLIRIISLGVRLAANITAGHLLLAIISGFVWEMVMNEWLFLGLGCSLILILVVGLEVGMALIQAYVF 220
124484823 140 VLAPFLIVVEAISYVSRAISLGVRLAANLIAGHLLFSIISGFAFSMLVGGLALLGLFPMLIMVFITLLEMAVAGIQAYVF 219
164421212 148 ILGPALILIETVSYLTRAVSLGVRLAANLSAGHLLFGILSGFVFNILAMGGVISSIFLILILFFIVVLEMAVAIIQAYVF 227
164421054 233 CLLTTIYLGDTVALH 247
164421199 221 CLLTIIYFKDAYELH 235
164421151 230 SLLTTIYLGDTIALH 244
164421169 221 CLLTIIYFKDAYELH 235
164421036 230 SLLTTIYLSDTIVLH 244
164421177 230 TLLTTIYFVDTIALH 244
164421132 230 MLLTTIYFVDTIALH 244
281428841 221 CLLTIIYFKDAYELH 235
124484823 220 CLLTTIYLGDTIALH 234
164421212 228 CLLTTIYLTDTIKLH 242
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap