Conserved Protein Domain Family
ATP6

?
MTH00174: ATP6 
ATP synthase F0 subunit 6; Provisional
Statistics
?
PSSM-Id: 133799
View PSSM: MTH00174
Aligned: 4 rows
Threshold Bit Score: 333.83
Threshold Setting Gi: 124359011
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
108860659   1 MVAAYFDQFNIIPIFSIWVYGGSigspFWINGEFFCVSNTLFMMSFAVFLFYTIgaKGVNgGSLIPNRVLTGLELIYSHF 80 
124358997   1 MVAAYFDQFNIIPIFSIWVYFLS----FWINGEFFCFTNTFFMMSFAVFLFYTI--TKNN-NTLVPNRILVGFELIFAHF 73 
124359025   1 MVAAYFDQFNIIPIFSIWVYFLS----FWINGEFFCFSNTFFMMSFAVFLFYTIsaEGAD--SLVPNRILTGLELIYSHF 74 
124359011   1 MVAAYFDQFNIIPIFSIWVYFLS----FWINGEFFCFTNTFFMMSFAVFLFYTIgvAPNN-NTLVPNRILVGLELIYTHF 75 
108860659  81 YTVLKDNLGNKGGNYLAFVLSLFILILFGNGLGLFPYVFTPTVHMVITLGLSFAIIMGTTLSGLITFRLNFFSILMPQGA 160
124358997  74 YTVLKDNLGDKGGNYLAFVLSLFILILFGNGLGLFPYVFTPTVHMVITLGLSFAIIVGTTLAGLITFRFNFFSILMPQGA 153
124359025  75 YTVLKDNLGNKGGNYLAFVLSLFVLILFGNGLGLFPYVFTPTVHMVITLGLSFAIIVGTTLSGLITFRLNFFSILMPQGA 154
124359011  76 YTVLKDNLGNKAGNYLAFVLSLFILILFGNGLGLFPYVFTPTVHMVITLGLSLTIIIGTTLAGLITFRFNFFSILMPQGA 155
108860659 161 PLALAPLLTAIETLSYISRAISLGVRLAANISSGHLLFSIIASFAWKMISTGILVGSFVPFAILIFVTILEMAVAIIQAY 240
124358997 154 PLALAPLLTIIETLSYISRAISLGVRLAANISSGHLLFSIIASFAWKMFNSGILIGSFVPFAILIFVTILEMAVAIIQAY 233
124359025 155 PLALAPLLTAIETLSYISRAISLGVRLAANISSGHLLFSIIASFAWKMISTGILVGSFVPFAILIFVTILEMAVAIIQAY 234
124359011 156 PLALAPLLTIIETLSYISRAISLGVRLAANISSGHLLFSIIASFAWKMINAGILIGSFVPFAILIFVTILEMAVAIIQAY 235
108860659 241 VFTLLTIVYLRDTVELH 257
124358997 234 VFTLLTIVYLRDTVELH 250
124359025 235 VFTLLTIVYLRDTVELH 251
124359011 236 VFTLLTIVYLRDTVELH 252
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap