Conserved Protein Domain Family
COX2

?
MTH00168: COX2 
cytochrome c oxidase subunit II; Provisional
Statistics
?
PSSM-Id: 177223
View PSSM: MTH00168
Aligned: 33 rows
Threshold Bit Score: 351.975
Threshold Setting Gi: 288903155
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
157384902   1 MSMYGGVGLQDAISYEGSGVVLFHDFALCVMVFILC-VVVAMFWSISAGgTSVVGGYSGS-NYVEIIWTTLPIVVLLGLS 78 
7335697     1 --MYNSLGLQDCFNYIGMEVYLFHDYSMLIVLFILI-GVMLSVLVILGSgGYMVKGYRSS-EFLELTWTVVPGFLLMSLG 76 
157384916   1 MSMYGGVGLQDTISYEGSGVELFHDFALCVMVFILC-VVVGMFYSITVGgGSVVSGYSGS-NYVEFIWTTLPVVVLLGLS 78 
28436204    1 MYPYSFMQLTDSNTFFGNEIVLFHDYSLASLVLILT-AVMSMAYIMKKK-KYVTLAYQGS-NMLEFLWTFFPVFILMSLG 77 
27228448    1 MYPYSFIQLTDSNTFFGHEIVLFHDFSLASLVFILT-AVLLMSKALKKK-KYVVLAYKGS-NMLEFLWTFFPVFILISIG 77 
242543532   1 MTTYSRMQFLDGANITSSGMIIFHDFAFSILMFILT-FVIFMSFISLSTyKHMRLFKEYSfNMLEMIWTLFPALVLLALG 79 
288903206   1 --MFQKINFHDASSPLMENLHYFHDWAMVIITSIAL-VSFVFLWQLFLL-KPIDRSFNEQ-QNIEWMWTILPGVILLGIG 75 
284177714   1 MTGFNSLLLQDSMNMAGAEIVLFHDYAMLLMSLILMgFVVFSLMVLKTG-SWFVKGYGSS-EMLEISWTMIPGFLLYSLG 78 
270267720   1 -MFFSRFGLMDGSNMVANCMLLFHDYCLVLMATILT-YVIFMFFICYKSrGFSVTTLQGS-NFLEMVWTIIPMFFLLSLG 77 
270267403   1 --MYNSLLLQDCYNNTGMEVVLFHDYSLMVLVLILVgFLVFSYAILGSG-NFFVKGYSSS-ELLEFSWTVVPGFLLLSLG 76 
157384902  79 FPSLALMYLSEGPQggSPDLTFKAIGHQWYWSYEGGDFL-DFSVDSYMMPLSELGGGDFRLLEVDNSLVLPFGSKIRLVT 157
7335697    77 VPSLFLMYYMEGAV--KYDLTVKAVGHQWYWSYEIGDYGeGIEFDSYMVGLDDLVVEIHRLLNVDNSLVLPYLTKIRVLV 154
157384916  79 FPSLALMYLSEGPPggSPDLTFKAVGHQWYWSYEGGDFL-DFGVDSYMAPLGDLSEGSFRLLEVDNSLVLPFGAKVRLVT 157
28436204   78 VPSLFLMYMMEGSF--KGDLTFKVVGHQWYWSYEGGDFN-DFNMISYQVGQYKITPGQFRLLEVDNSLVLPYSTNVRMMI 154
27228448   78 LPSLYLMYLLEGSF--KGDLTFKVVGHQWYWSYEGGDFN-DFDMSSYMVPSEDLQEGQFRLLEVDNSMVLPYSTNIRLMI 154
242543532  80 VPSFLMMYFLEGEL--KGDLTVKAVGHQWFWSYEGNDLV-SFDFDSYMKLDDSLSMGDNRVLEVDNSLVLPMMTKIRMII 156
288903206  76 FPSIRILYLLDENG--APSLSLKAIGHQWYWSYEYNDFN-SLEFDSYM------TNSSYRLIDTDHRLILPTWAHIRVLV 146
284177714  79 VPSLFLMYYIEGNT--KYDLTLKVTGHQWYWSYEVSEYGgEMSFDSYMINDEDLQVGGYRLLDVDNSVVLPYLSKIRVLV 156
270267720  78 LPSFMMMYYLEGES--KGDLTYKVIGHQWYWSYENNDFI-DYSFDSYMLPLEEMNVGDNRLLEVDNGLTLPYGSLNRMVI 154
270267403  77 VPSLFLLYFMEGVT--KSNLTLKAMGHQWYWSYEMNEFGvGFGFDSYMSDRGA-ELGGYRLLDVDQQVELPYMAKVRVLI 153
157384902 158 SSTDVIHCWALPSLALKVDCVPGRLNTLQVGSTVPGSFFGQCSEICGINHSFMPIHVEFVDWDSFLTYVAQ 228
7335697   155 GSGDVLHAWALPSGGLKADACPGRLNVLSLGVCRPGSMYGQCSEICGVNHSFMPIHVEWVSWEDFLMSHAA 225
157384916 158 SSTDVIHCWALPSLAMKVDCVPGRLNTLSVSSVSPGSFYGQCSEICGINHSFMPIHVEFVDWGTFLAYVAQ 228
28436204  155 TSVDVIHSWTLPSLKMKVDAVPGRLNTMNIFSFKPGSFYGQCSEICGLYHSFMPIHVEFVNWETFLN---- 221
27228448  155 TSYDVIHSWTLPSLKMKVDAVPGRLNTMNIFSFQPGSFYGQCSEICGLLHSFMPIHVEFVNWETFLNHVTE 225
242543532 157 TSTDVLHSWALPSMCLKMDAIPGRLNTMNIISLYPGSFYGQCSEICGINHSFMPIHVEFVGWKDYIKNLTS 227
288903206 147 TAADVLHSWTLPTMGIKADAIPGRLNQLLFSIDRPGFYYGQCSEICGSNHSFMPITLEAYSPSTFCKIFDS 217
284177714 157 TSGDVLHAWALPSMGMKIDAIPGRLNFMNIMSFRPSSVYGQCSEICGVNHSFMPIHIEFVGWEGFLNANVA 227
270267720 155 TSTDVLHAWALPSMCLKVDAVPGRLNTLSLFSLSPGTFYGQCSEICGINHSFMPIKVEFIGWNDFLKSLFN 225
270267403 154 SSXDVLHSWALPSMGLKADACPGRLNMLNIVSFRPGSIFGQCSEICGVNHSFMPIHLEFCDWDSFLSGVTV 224
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap