Conserved Protein Domain Family
COX1

?
MTH00167: COX1 
cytochrome c oxidase subunit I; Provisional
Statistics
?
PSSM-Id: 177222
View PSSM: MTH00167
Aligned: 45 rows
Threshold Bit Score: 826.623
Threshold Setting Gi: 288903216
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
242543523   1 MSLGRWFMSTNHKDIGTLYFFLGIYSALVGTGLSMIIRTELSQTGQLIG--NGQIYNVVVTAHALLMIFFFIMPVMIGGF 78 
27228455    9 AWLTRWMFSTNHKDIGTLYFIFGTWSGIIGTSLSVIIRMELSQGGGVIN--NGQIYNVVVTSHAFVMIFFFVMPIMVGGF 86 
7335691     3 MWFLRWFMSTNHKDIGTLYFLFGVWAGFVGTGMSVFIRMELSQVGQVIG--DGQLYNVVVTAHAFVMIFFFVMPVMIGGF 80 
28436199    3 NWLNRWLFSTNHKDIGTLYFMFGTWSGLIGTALSIIIRMELSQPGGVIDneNGHIYNVVVTSHAFVMIFFFVMPIMIGGF 82 
157384913   1 --MRRWLMSTNHKDIGTLYFLFGIFAGVVGTAMSVIIRLELSQSGLVIG--DGQVYNVIVTAHAFVMIFFFVMPIMIGGF 76 
57642243    1 --MVRWLFSTNHKDIGTLYFLFGMWAGMIGTGMSVLIRIELGKAGTVWAd-DGQVYNVMVTAHAFVMIFFFVMPVTLGGF 77 
270267393   1 MWLKRWLMSTNHKDIGTLYFLFGIWAGFIGTGMSVIVRTELSQVGQVIG--DGQLYNVMVTAHAFVMIFFFVMPIMIGGF 78 
270267453   2 SWFMRWFMSTNHKDIGTLYFIFGIFSGFIGSGMSVLIRTELSQVGQVIG--DGQLYNVVVTAHAFVMIFFFVMPVMIGGF 79 
270267728   4 KWCFRWLMSTNHKDIGTLYFIFGIWSAFFGTALSLLVRLELSQTGQVIG--NGQIYNVLVTAHALIMIFFFVMPTLIGGF 81 
284177726   5 MWVNRWLMSTNHKDIGTLYFIFGIWAGFVGTGMSVLIRVELSQVGQVIG--DGQLYNVIVTAHAFVMIFFFVMPIMIGGF 82 
242543523  79 GNWLLPMMVGSPDMAFPRLNNMSFWLLPPALFLLVLSVFN-GDGVGTGWTIYPPLSGILAHSSGAVDMGIFSLHLAGVSS 157
27228455   87 GNWLIPLMVGAPDMAFPRMNNMSFWLLPPSFFLLLKSGFSgSAGVGTGWTVYPPLSANIGHSNTGVDMAIFSLHLAGVSS 166
7335691    81 GNWLLPLMLGCPDMAFPRLNNMSFWLLPPALFMLLLSSVI-ESGVGTGWTVYPPLSGNLAHSGPALDCAIFSLHLAGVSS 159
28436199   83 GNWLIPMMIGAPDMAFPRMNNMSFWLLPPAFFMLLKSSFAgASGVGTGWTVYPPLSATVGHAHSGVDMAIFSLHLAGVSS 162
157384913  77 GNWLLPMMVGAPDMAFPRLNNMSFWLLPPALFLLLVSSVV-GSGAGTGWTVYPPLAGNLAHAGASVDCAIFSLHLAGVSS 155
57642243   78 GNWLIPLMVGAPDMAFPRMNNLSFWLLPPAFFLLLLSSFV-GGGAGTGWTVYPPLSGNLAHAGPSVDCAIFSLHLAGVSS 156
270267393  79 GNWLLPLMVGSPDMAFPRMNNMSFWLLPPALFLLLISSVI-EAGVGTGWTVYPPLAGNLAHSGPGLDCAIFSLHLAGVSS 157
270267453  80 GNWLLPLMLGSPDMAFPRLNNMSFWLLPPALVFLLISSFI-ESGVGTGWTVYPPLAGNLAHSGGALDCAIFSLHLAGISS 158
270267728  82 GNWLLPLMIGAPDMAFPRLNNMSFWLLPPSLVFLCLSVFV-GDGVGTGWTIYPPLSSGLAHSSGAVDMGIFSLHLAGISS 160
284177726  83 GNWLLPLMLGSPDMAFPRLNNMSFWFLPPALFLLLVSSLI-ESGAGTGWTVYPPLAGNLAHSGPAVDAAIFSLHLAGVSS 161
242543523 158 ILGSMNFLVTMSNMKLkGFDYNNLSLFCWSVVVTTVLLVLSLPVLAAAITMLLFDRNLNTSFFDPMGGGDPILFQHLFWF 237
27228455  167 ILGSVNFLVTLFNMKNkGKSMSNLSLFCWSLIVTTILLVLSLPVLAAAITMLLFDRNFNTTFFDPNGGGDPILYQHLFWF 246
7335691   160 ILGSLNFMTTMFNMGLkGGGLFMMPLFCWSVLITTLLLLLSLPVLAAAITMLLFGRNLNTSFFDPAGGGDPVLYQHLFWL 239
28436199  163 ILGSVNFLVTLFNMKNkGKSMGDLSLFCWSLIVTTILLVLSLPVLAAAITMLLFDRNFNTSFFDPNGGGDPILYQHLFWF 242
157384913 156 ILGSINFLVTMMNMKAkGFGAYNISLFCWSVIFTTILLVLSLPVLAAAITMLLFDRNANSSFFDPGGGGDPILYQHLFWF 235
57642243  157 ILGSINFLVTMMNMMSkGQTYGNLSLFCWSIVVTTILLILSLPVLAAAITMLLFDRNFNTSFFDPAGGGDPILYQHLFWF 236
270267393 158 ILGSLNFMTTLFNMKSkGWGMFSMPLFCWTVLVTTVLLLLSLPVLAAAITMLLFDRNFNTSFFDPAGGGDPVLYQHLFWF 237
270267453 159 ILGSLNFMTTMFNMKTkGWVMFSMPLFCWTVLVTTLLLLLSLPVLAAAITMLLFDRNINTSFFDPVGGGDPVLYQHLFWF 238
270267728 161 ILGSMNFLVTLGNMKAkGLNYSQFSLFCWSIIVTTILLILSLPVLAAAITMLLFDRNLNTSFFDPSGGGDPILFQHLFWF 240
284177726 162 ILGSLNFMTTMFNMKAkGWGMFTMPLFCWTVLVTTVLLLLSLPVLAAAITMLLFDRNLNTSFFDPAGGGDPVLYQHLFWF 241
242543523 238 FGHPEVYILILPGFGMISQIVVFYSGKDNIFGYYGMVWAMCGIGFLGFLVWAHHMFSVGMDVDSRAYFTAATMIIAVPTG 317
27228455  247 FGHPEVYILILPGFGMISHVIVFYSGKDNIFGYYGMVWAMGGIGFLGFLVWAHHMFSVGMDVDSRAYFTSATMIIAVPTG 326
7335691   240 FGHPEAYILILPGFGMISHIIVFYTNKEVVFGFYGMVWAIIGIGFLGFLVWAHHMFTVGMDVDSRAYFTAATMVIAVPTG 319
28436199  243 FGHPEVYILILPGFGMISHVIVFYSGKDNIFGYFGMVWAMGGIGFLGFLVWAHHMFSVGMDVDSRAYFTSATMIIAVPTG 322
157384913 236 FGHPEVYILILPGFGMISHVVVFYSGKSSIFGYYGMVWAMGSIGLLGFLVWAHHMFTVGVDVDARAYFTAATMVIAVPTG 315
57642243  237 FGHPEVYILILPGFGIVSHTVAYYSGKKEVFGYYGMVWAMLGIGFLGFLVWAHHMYTVGMDTDSRAYFTAATMVIGVPTG 316
270267393 238 FGHPEVYILILPGFGMVSHVVVFYSNKEKVFGFYGMVWAVIGIGFLGFLVWAHHMFTVGMDIDSRAYFTAATMVIAVPTG 317
270267453 239 FGHPEVYILILPGFGMISHVITYYTNKDLVFGFYGMVWAVIGIGFLGFLVWAHHMFTVGMDIDSRAYFTAATMVIAVPTG 318
270267728 241 FGHPEVYVLILPGFGIISQVVVFYSGKESIFGYYGMVWAMCGIGFLGFLVWAHHMFSVGMDVDSRAYFTAATMIIAVPTG 320
284177726 242 FGHPEVYILILPGFGMVSHIIMFYTNKELVFGFYGMIWAIIGIGFLGFLVWAHHMFTAGLDVDSRAYFTAATMVIAVPTG 321
242543523 318 IKIFSWVSTLLGGLITWSLSMYWFFGFLFLFTIGGLTGIVLANCSLDLVLHDTYYVVAHFHYVLSMGAVFTIFAGFFHWF 397
27228455  327 IKVFSWVSTLLGAKIHWGLPLLWAYGFLFLFTIGGLTGIVLANCSLDLVLHDTYYVVAHFHYVLSMGAVFAIFSGFFHWS 406
7335691   320 IKVFSWVSTLVGAKIVWHIAMYWVCGFLFLFTLGGLTGIILSNCSLDLVLHDTYYVVAHFHYVLSMGAVFAIFAGFAHWY 399
28436199  323 IKVFSWVSTTLGAKVHWGLAMIWAYGFLFLFTIGGLTGIVLANCSLDLVLHDTYYVVAHFHYVLSMGAVFAIFSGFFHWF 402
157384913 316 VKVFSWLGTLVGGRIHMGLALYWAFGFLFLFTVGGLTGIALANCSLDLVLHDTYYVVAHFHYVLSMGAVFAIMAGFYHWY 395
57642243  317 IKVFSWMGTMAGGRLDWGISFYWTAGFLFLFTIGGLTGIVLSNSSMDLVLHDTYYVVAHFHYVLSMGGVFAVFAGFTHWY 396
270267393 318 IKVFSWISTMVGAKMVWNVPLYWVCGFLFLFTFGGLTGIVLSNCSLDLVLHDTYYVVAHFHYVLSMGAVFSIFAGFTHWY 397
270267453 319 IKVFSWLSTMLGAKIIWNVPMYWVFGFLFLFTFGGLTGIILSNCSLDLVLHDTYYVVAHFHYVLSMGAVFAIFAGFTHWY 398
270267728 321 IKVFSWISTVLGGNVYWSLSMLWFFGFLFLFTIGGLTGIVLANCSLDLVLHDTYYVVAHFHYVLSMGAVFAIFCGFYHWF 400
284177726 322 IKVFSWVGTLMGAKIIWHTAMYWVSGFLFLFTIGGLTGIILANCSLDLVLHDTYYVVAHFHYVLSMGAVFAIFAGFNHWY 401
242543523 398 PLFYGLVFNDILGKIHFWLMFIGVNLTFFPQHFLGLAGM-PRRYNDFPDFFLTWNIISSVGSMISVAGVLFFMLMAWESI 476
27228455  407 PLFTGLSFNLILGQIHFFMMFVGVNLTFFPQHFLGLSGM-PRRYNDYPDFYLTWNVVSSIGSLLSGVAVVVFFLMLWESF 485
7335691   400 SLFTGLQMSHYLGLVQFWVMFIGVNLTFFPQHFLGLAGMpPRRYNDFSDFYLFWKVASSIGSLMSSLGALLFGCMIWESM 479
28436199  403 PLFTGLSFNSFLGKIHFTMMFVGVNLTFFPQHFLGLSGM-PRRIHDYPDFFMTWNVISSVGSLISGVAVAIFFLMLWESF 481
157384913 396 PLFTGLSFNYTLGLAHFFIMFIGVNVTFFPQHFLGLMGM-PRRYTDYPDFYYGWNLMSSYGSSLSAFGVVVLFMVIWESM 474
57642243  397 PVFTGLSFNKILGEAHFYTTFIGVNLTSFPQHFLGLTGM-PRRYNDFPDFFLAWNTVSSVGSMVSVFGVVLFLVMLWESM 475
270267393 398 SLFTGLMFNQVLGIAQFWLMFVGVNLTFFPQHFLGLAGM-PRRYNDFSDFYLMWNVMSSIGSLISVVGVIMFMVMIWESM 476
270267453 399 PLFTGLYLNKELAILQYWVMFVGVNMTFFPQHFLGLAGM-PRRYNDFSDFYLMWNVVSSVGSLLSVFGVVLFMGVIWVSF 477
270267728 401 PLFFGLSFNKFLGQVHFWLMFIGVNLTFFPQHFLGLAGM-PRRYNDYPDFYLTWNVLSSFGSLLSTVSILIFVVLLWEGL 479
284177726 402 GLFTGLQLNGLLMNVQFWIMFLGVNLTFFPQHFLGLAGM-PRRYNDFPDFYLLYNVISSIGSIMSVAGVVLFVYAIWLSF 480
242543523 477 ISKVEIENIEHShSGALEFTIGVPPMSHTWMEGPFKA 513
27228455  486 YSKRFLFTVE---SKSLEFKLGFPPALHTWMTSPVFK 519
7335691   480 ISNRKVYAAEET-GSYLEWSCGTPPPSHTWMEGPVIM 515
28436199  482 FSKRFMYNVG---SKSLEFQMGFPPALHTWMVSPVMK 515
157384913 475 YSQKPMYAVE---GGGLEWSLGLPPSSHTWIESPYMG 508
57642243  476 TVMRFASTYE---LDALEFA-EVPPQAHTWMESPVFG 508
270267393 477 SSSRYLYKVEAD-YNSLEWMNGTPPANHTWLEGPLTL 512
270267453 478 VSDSPLIGVNGG-NHNLEWANGTPPMGHTWMEGPVYI 513
270267728 480 INKRVFYEAEAHiSGAMEFSNGIPPMLHTWMGSPFIN 516
284177726 481 VEVPEIYYIDSS-FKAMEWSLGTPPPLHTWVEGPITM 516
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap