Conserved Protein Domain Family
ND3

?
MTH00161: ND3 
NADH dehydrogenase subunit 3; Provisional
Statistics
?
PSSM-Id: 177217
View PSSM: MTH00161
Aligned: 189 rows
Threshold Bit Score: 42.0711
Threshold Setting Gi: 45544571
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
124358971   1 MLMGWMGVVGGLVGVLSVLGYSVSKKSgWVSVEKSSPFECGFIPSSSARVSFSLHFFLVALIFIVFDVELLLLYPYVVSF 80 
81230442    1 -------MILFLCFILFSLMWFLSKEE--ESNSKNTPFESGFSAKNMS-ISFSNQYYLVAILFLVFDLEIVLTFPIPLSL 70 
81230456    1 -------MILFLCFIFFSLIWFFSNKE--ESYGKNSSFESGFDSKNLS-ISFSNQYYLVAVLFLIFDLEIVLTFPIPLSM 70 
171260059   1 -MIIFLFMILFMIIMLLSLYLMFYKNEnMMNYNFSSMYECGFMNMTFSRFFFSMNMFIYLILFIVLDMEIFFLSLMVFYE 79 
183398057   1 --MNIMMTTLMLMIMLITTWTIISPTE-KENQTMNSPFESGFENFNSSFIPFSSQYFMIALVFLIFDLEIVMTLPMPQST 77 
182894314   1 --MLMMISSFWLIFVLLTIWSIFSFME-KENQIMNSAFESGFESSQTSFIPFSVQYFMVSLVFLIFDLEIVLTLPIPISN 77 
225012914   1 MLFFVLFMVLVFFLLVVLLSYFFMGSE-FY---KSSPFECGFQPFMVSGSSFSMPFFVISLMFLLFDVEIIIMSFPPFVS 76 
226968601   1 -----MMIFTLMFMMYMFYFFFLNYSM-SMNLNFSSMYECGYMNLTYSRFYFSMYNYMYLILFLVLDLEIFFISLMIYLN 74 
301353319   1 -----MTMLILMLILYLLYYFFLNTSK-SLNLNFSSMYECGYMNLNYSRFYFSIYNYMYLILFLILDLEIFFISLMIYF- 73 
302632626   1 -MMKFLFMILFMINIMLILYFLFYKNEnMMNYNFSSMYECGFMNMTFSRFFFSMNMFIYLILFIILDMEIFFLSLMVFYE 79 
124358971  81 SdngvseVGRGSVFRSsdCFFKCGMFLGVVLWNIKLKVMI 120
81230442   71 S-----------KSALlgALFFLFFALVLFYEWKFGLLDW 99 
81230456   71 S-----------KSGFlgSLFFLFFSVVLLFEWKFGLLDW 99 
171260059  80 M-----------SFLIilNTFIFSMILLMIYEWFSMSLNW 108
183398057  78 E------KEKTT---TmvSAFLVALMILMMKEMKISSTEW 108
182894314  78 D------MIKSF---MlsSLFMITLVIILFKEMKTSSIDW 108
225012914  77 E------YFFIYYW-----FVILLVLLATCYEWLSGILSW 105
226968601  75 F-----------NFLMllNVFMFFLIFMILYEWLSLSLDW 103
301353319  74 ----------NFNFLMmmMVFIFFLIFMMLYEWINLSLDW 103
302632626  80 M-----------SFLIilNTFIFSMALMMLYEWFSMSLNW 108
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap