Conserved Protein Domain Family
COX1

?
MTH00153: COX1 
cytochrome c oxidase subunit I; Provisional
Statistics
?
PSSM-Id: 177210
View PSSM: MTH00153
Aligned: 253 rows
Threshold Bit Score: 769.805
Threshold Setting Gi: 302632625
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
49146479    1 MKKWFFSTNHKDIGILYFIFGIWSGFIGASMSLLIRVELSVLGSYMNNDQMYNTLVTSHAFIMIFFMTMPLVIGGFGNWL 80 
5834927     1 MMKWFMSTNHKNIGILYIILALWSGMLGSSMSLIIRMELSSPGSWISNDQIYNTIVTSHAFLMIFFMVMPFLIGGFGNWL 80 
27733918    1 MNKWLMSTNHKNLGILYMIFALWSGMIGSSFSMLIRMELNSPGMWINNDQIYNSIVTSHAFLMLFFMVMPFLIGGFGNYL 80 
190349386   1 MKKWLMSTNHKNIGMMYFIFAMWSGMIGSSTSLLIRMELSHPGMWINNDQIYNSLVTSHAFLMIFFMVMPFMIGGFGNYL 80 
221143402   1 MKKWLMSTNHKNIGMMYFIFAMWSGMIGSSMSLLIRMELSHPGMWINNDQIYNSLVTSHAFLMIFFMVMPFMIGGFGNYL 80 
225012909   1 -MRWLMSTNHKDIATLYFIFGVWSGMLGTSFSSLIRLELSQPGDFSMDFDYYNSVVTAHAFIMIFFMVMPIMMGGFGNLL 79 
256985337   1 MGRWLMSTNHKDIATLYFVFGVWSGMLGTSFSSLIRLELSQPGDFSMDFDYYNSVVTAHAFIMIFFMVMPIMMGGFGNLL 80 
299827776   1 MMKWLMSTNHKDIGMLYFMFGLWSGMLGFSMSLIIRLELGMPGSLIGNDQIYNSIVTSHAFIMIFFMVMPVMIGGFGNWL 80 
299890912   1 MMKWFMSTNHKNIGILYILLALWSGMLGSSMSLIVRMELSSPGSWINNDQIYNTVVTSHAFLMIFFMVMPFLIGGFGNWL 80 
301353318   1 -MKWMFSTNHKNIGTMYFMFSLFSGLMGTSFSMIIRMELMQPGSIIQNDFIYNSFITIHAMIMIFFMVMPAMIGGFGNWL 79 
49146479   81 VPLMVGAPDMAFPRMNNLSFWLLMPSLMFLILSMLVSGGGGTGWTVYPPLSTSMFHSGCSVDLMIFSLHLAGISSILGSI 160
5834927    81 IPLMLGSPDMAFPRMNNISFWLLPPSLFMLLLSNLFYPSPGTGWTVYPPLSAYLYHSSPSVDFAIFSLHMSGISSIMGSL 160
27733918   81 VPLMLGSPDMAFPRMNNISFWLLPPSLMLLLLSNMFFPNSGTGWTVYPPLSLYLYHSSPSVDFTIFSIHMTGISSILGSL 160
190349386  81 IPLMLGSPDMAFPRMNNISFWLLPPSLFMLLLTNLFSPNVGTGWTIYPPLSSYLFHSSPSIDIAIFSLHMSGISSIIGSL 160
221143402  81 IPLMLGSPDMAFPRMNNISFWLLPPSLFMLLLSNTFTPNVGTGWTIYPPLSSYLFHSSPSIDIAIFSLHMSGISSIIGSL 160
225012909  80 VPLMIGATDMAYPRLNNMSFWLLPPSLSLLVSSAVVGSGVGTGWTVYPPLSNGIFHSGPAVDFGILSLHIAGVSSILGAI 159
256985337  81 VPLMIGATDMAYPRLNNMSFWLLPPSLSLLVSSAVVGSGVGTGWTVYPPLSNGIFHSGPAVDFGILSLHIAGVSSILGAI 160
299827776  81 IPLMLGSPDMSFPRMNNMSFWLLIPSLLLLILSSFINVGVGTGWTVYPPLSLILGHGGMSVDLGIFSLHLAGASSIMGAV 160
299890912  81 IPLMLGSPDMAFPRMNNISFWLLPPSLFMLLLSNLFYPSPGTGWTVYPPLSAYLYHSSPSVDFAIFSLHMSGISSIMGSL 160
301353318  80 IPLMINSMDLCFPRLNNMSFWMLIPSLILMLNSSLKGVLNGVGWTMYPPLTSIQYFMSSSIDMMIFSLHIAGLSSIASSI 159
49146479  161 NFITTIINMRLIGMKLENMPLFVWSVLITVFLLLLSLPVLAGAITMLLMDRNFNSTFFDPMGGGDPILYQHLFWFFGHPE 240
5834927   161 NLMVTIMMMKNFSMNYDQISLFPWSVFITAILLIMSLPVLAGAITMLLFDRNFNTSFFDPMGGGDPILYQHLFWFFGHPE 240
27733918  161 NFIVTIFMMKNFSLNYDQINLFSWSISITVILLILSLPVLAGAITMLLFDRNFNTSFFDPMGGGDPILYQHLFWFFGHPE 240
190349386 161 NFIVTILMMKNFSLNYDQINLFSWSVCITVILLILSLPVLAGAITMLLFDRNFNTSFFDPMRGGDPILYQHLFWFFGHPE 240
221143402 161 NFIVTILMMKNFSLNYDQINLFSWSVCITVILLILSLPVLAGAITMLLFDRNFNTSFFDPMGGGDPILYQHLFWFFGHPE 240
225012909 160 NFIVTIFNMKVQGMGWSNVPLFVWSVFITSFLLAFSLPVLAAALTMLLTDRNFNSTFFDPVGGGDPILYQHLFWFFGHPE 239
256985337 161 NFIVTIINMKVEGMGWSSVPLFVWSVFITSFLLAFSLPVLAAALTMLLTDRNFNSTFFDPVGGGDPILYQHLFWFFGHPE 240
299827776 161 NFITTIMNMRSNLFNMDKMSLFSWSVFITAILLLLSLPVLAGAITMLLTDRNMNTSFFDPSGGGDPILYQHLFWFFGHPE 240
299890912 161 NLMVTIMMMKNFSLNYDQISLFPWSVFITAILLIMSLPVLAGAITMLLFDRNFNTSFFDPMGGGDPILYQHLFWFFGHPE 240
301353318 160 NFISTILLMKNKNFFFSMMTLFSMSILITTFLLLIALPVLAGGITMILMDRNFNTSFFDPSGGGDPILYQHLFWFFGHPE 239
49146479  241 VYVLILPGFGIISHLISNESGKMEVFGSLGMIYAMLTIGILGFIVWGHHMFTVGMDVDTRAYFTSATMVIAIPTGIKIFS 320
5834927   241 VYILILPGFGLISHIVMNESGKKEIFGNLSMIYAMLGIGFLGFIVWAHHMFTVGLDVDTRAYFTSATMIIAVPTGIKVFS 320
27733918  241 VYILILPGFGLISQIIMNESGKKEIFGNLSMIYAMLGIGFLGFIVWAHHMFTVGLDIDTRAYFTSATMIIAIPTGIKVFS 320
190349386 241 VYILILPGFGLISQIIMNESGKKETFGNLSMIYAMLGIGFLGFIVWAHHMFTVGLDVDTRAYFTSATMIIAVPTGIKVFS 320
221143402 241 VYILILPGFGLISQIIMNESGKKETFGNLSMIYAMLGIGFLGFIVWAHHMFTVGLDVDTRAYFTSATMIIAVPTGIKVFS 320
225012909 240 VYILILPGFGIISHTVSFYSNKIEPFGSLGMIYAMISIATLGFIVWAHHMFTVGLDVDTRAYFTSATMIIAVPTGVKVFS 319
256985337 241 VYILILPGFGIISHTVSFYSNKVEPFGSLGMIYAMVSIAVLGFIVWAHHMFTVGLDIDTRAYFTSATMIIAVPTGVKVFS 320
299827776 241 VYILILPGFGIISHMIFNESGKKETFGMLGMIYAMLTIGFLGFIVWAHHMFTIGMDVDTRAYFTSATMIIAIPTGIKIFS 320
299890912 241 VYILILPGFGLISHIVMNESGKKEIFGNLGMIYAMLGIGFLGFIVWAHHMFTVGLDVDTRAYFTSATMIIAVPTGIKVFS 320
301353318 240 VYILILPGFGMISHVISYNLGKKEVFGKMGMMFAMMSIGLLGFVVWAHHMFTVGMDVDTRAYFTAATMIIAIPTGIKIFS 319
49146479  321 WLATFSGINFKfNNPLMLWSMGFLFLFTLGGLTGVILGNSSVDVCLHDTYFVVAHFHYVLSMGIVFAIISGFIFWFPLII 400
5834927   321 WLATYHGSKLK-LNISILWSLGFIMLFTIGGLTGIMLSNSSIDIILHDTYYVVGHFHYVLSMGAVFAIISSFIHWYPLIT 399
27733918  321 WLATYHGSKLN-FNISFMWSIGFILMFTIGGLTGIMLSNSSIDIILHDSYYVVGHFHYVLSMGAVFSIIASFIHWFPLIS 399
190349386 321 WLATYHGSKMN-FNITIIWSIGFILMFTIGGLTGVMLSNSSIDIILHDTYYVVGHFHYVLSMGAVFAIITSLIHWYPMIT 399
221143402 321 WLATYHGSKMN-FNITIIWSIGFILMFTIGGLTGVMLSNSSIDIILHDTYYVVGHFHYVLSMGAVFAIISSIIHWFPMIT 399
225012909 320 WLATMLGGKLD-FSPSFLWSMGFVFLFTVGGLTGVILSNSSLDVSLHDTYYVVAHFHYVLSMGAVFAIMAGITHWFPVMY 398
256985337 321 WLATMLGGKLD-FSPSFLWSMGFVFLFTVGGLTGVILSNSSLDVSLHDTYYVVAHFHYVLSMGAVFAIMAGITHWFPAIY 399
299827776 321 WMATFSGVKLI-NNLMILWTMGFIFLFTVGGLTGVVLSNSSVDVVLHDTYYVVAHFHYVLSMGAVFSILGGFIYWFPMFF 399
299890912 321 WLATYHGSKLK-LNISVLWSLGFIMLFTIGGLTGIMLSNSSIDIILHDTYYVVGHFHYVLSMGAVFAIISSFIHWYPLIT 399
301353318 320 WFTTMINSHIN-FNISIYWSMGFLIMFSIGGFTGIIASNSCLDIALHDTYYIVAHFHYVLSMGAVFAIFSGLFMWFPLMY 398
49146479  401 GLTLNSNLLISQFYIMFIGINMTFFPQHFLGLNGMPRRYSDYFDCYLFWNKISSMGSLISFLGILYFLYIILESFIMIRL 480
5834927   400 GLLLNIKWLKIQFIMMFIGVNLTFFPQHFLGLMSMPRRYSDYPDSYYCWNSISSMGSMISLNSMIFLIFIILESLISKRM 479
27733918  400 GLMMNQKWLKFQFFFMFIGVNLTFFPQHFLGLMGMPRRYSDYPDSYYCWNMISSLGSMISMNSLLFMMFIIFESLMSKRF 479
190349386 400 GLLMNQKWLKIQFIMMFIGVNMTFSPQHFLGLMSMPRRYPDYPDSYYCWNLISSIGAMISMNSMLFLIFIIFESFISKRL 479
221143402 400 GLMMNQKWLKIQFIMMFIGVNMTFFPQHFLGLMSMPRRYSDYPDSYYCWNLISSIGAMISMNSMLLLIFIIFESLISKRL 479
225012909 399 NMPMNPYLLKGQFWVMFLGVNLTFFPQHFLGLNGMPRRYCDYPDGFTYWNTISSLGSFITVMSIVIFIFIMWEGMSSGRV 478
256985337 400 NIPMNPYFLKGQFWVMFLGVNLTFFPQHFLGLNGMPRRYCDYPDGFTYWNTVSSLGSLVTVMSIVFFVFIIWEGVSSGRV 479
299827776 400 GLMMNEYFLKIHFYLTFIGVNLIFFPQHFLGLSGMPRRYSDYPDMYLNWNLFSSFGSLISLVGVFLFIFIIWESLIMQRF 479
299890912 400 GLLLNVKWLKIQFIMMFIGVNLTFFPQHFLGLMSMPRRYSDYPDSYYCWNSISSLGSMISLNSIIFLIFIILESLISKRM 479
301353318 399 NFYMNMNFLKIHFWSSMIGINLTFFPQHFLGLMGMPRRYSDYLDSMYMWNFLSSLGSMITFISTVFFLYIMLEMFLMNKM 478
49146479  481 LNFKIFMINFLEWMINYPSLDHSFKELGLIFK 512
5834927   480 LLFKFN-QSSLEWLNFLPPLDHSHLEIPLLIK 510
27733918  480 ILFKFH-QSSLEWLNNYPPFNHMCNEIPLLMK 510
190349386 480 ILFKFH-QSSLEWLNNYPPFDHSLIEIPLISK 510
221143402 480 ILFKFH-QSSLEWLNNYPPFDHFLMEIPLISK 510
225012909 479 INYYSSNLISSEFYYESPAPSHTNVEAWKVCS 510
256985337 480 VNQYTSNLTTSEFFYDSPSPSHTNVEAWKVFN 511
299827776 480 VIFVKFINSSIEWFHLYPPLDHSYDETLKVSI 511
299890912 480 MLFKFN-QSSLEWLNFYPPLDHSHLEIPLLIK 510
301353318 479 ILMFESNSNNMEFFFFSPLESHTMMNFNLIMF 510
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap