Conserved Protein Domain Family
CYTB

?
MTH00145: CYTB 
cytochrome b; Provisional
Statistics
?
PSSM-Id: 177203
View PSSM: MTH00145
Aligned: 73 rows
Threshold Bit Score: 497.12
Threshold Setting Gi: 224587980
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
62161118   15 SVGPWRSTNKLVKIMNDSFYD--------------------LPCPVNLNAWWSFGSMLGLCLVIQLLSGLLLSAHYTAHE 74 
68989136    1 MLSVLLKASPTVKSYYSEILK--------------------YPCPPSLTNWWNLGSMLFLILGSQILSGLILTMNYTADE 60 
153123680   1 ---MSIGSGAIYPVVKGTFYD--------------------LPCPANLSVWWGLGSLLGVCVAGQVLTGWFLSFYYTAHE 57 
7212447     1 -----------------------------------------------------MGSMLFLILGAQILTGVMLTMNYTADE 27 
229324854   7 EVGADDGSGKSSSVYYYEALK--------------------YPCPPNLSIWWNMGSMLFLILGAQILTGVMLTMNYTADE 66 
229324834   8 EAGADDGPGKSVSNYYYEALK--------------------YPCPPNLSVWWNMGSMLFLILGAQILTGVMLTMNYTADE 67 
229328223   8 EEGADDGPHEMSPNYYYNALK--------------------YPCPPNLSIWWNIGSMLFLVLGAQLLTGILLSTSYTPDE 67 
254033635   2 TKNISIGSGAIYPVVKGTFYD--------------------LPCPANLSVWWGLGSLLGVCVAGQVLTGWFLSFYYTAHE 61 
281190778   9 SVGAEDSSDKSSAVYYYDALK--------------------YPCPPNLSIWWNMGSMLFLILGAQILTGILLTMNYTADE 68 
292496226   1 --VTFKDKSTVLTGGNATECDggfsdessesdghyyydalkYPCPPNLSVWWNMGSMLFLVLGAQILTGIMLTTNYSSDE 78 
62161118   75 DMAFDSVVHIMRNVEKGWMLRNIHANGSSMFFICIYAHIARGLYYGSYLDK-TVWYFGVHLFLLTMAEAFLGYTLPWGQM 153
68989136   61 SLAVVSIDYMMRDANYGWIIRSLHMGGASLFFALTYAHVARGVFYGAYLKNpHVWYSGLSLYILSMGVGFLGYVLPWGVM 140
153123680  58 DLAYSSVIFIMKEVNFGWLMRSFHINVANFMFVCLYFHVGRGIYYGSFRMY-KVWATGVVLLLLVMLTAFTGYVLPWSQM 136
7212447    28 QLAVVSVDYIMRDANYGWIIRSLHMGGASMFFALIYMHIARGVYFGAYLKNtHVWYSGLTLYLLSMGVGFLGYVLPWGVM 107
229324854  67 QLAVVSVDYIMRDANYGWIIRSVHMGGASMFFALIYMHIARGVYFGAYLKNpHVWYSGLTLYLLSMGVGFLGYVLPWGVM 146
229324834  68 QLAVVSVDYIMRDANYGWIIRSLHMGGASMFFALIYMHIARGVYFGAYLKNtHVWYSGLTLYLLSMGVGFLGYVLPWGVM 147
229328223  68 ALASVSLEYVMRDSNYGWAVRSLHMGGASMFFALIYTHVARGVYFGVYLKNpHVWYSGLSLYVLSMGVGFLGYVLPWGVM 147
254033635  62 DLAYSSVIFIMKEVNFGWLMRSFHINVANFMFVCLYFHVGRGIYYGSFRMY-KVWATGVVLLLLVMLTAFTGYVLPWSQM 140
281190778  69 QLAVMSVDYIMRDANYGWIIRSLHMGGASMFFALIYMHIARGVYFGAYLKNpHVWYSGLTLYLLSMGVGFLGYVLPWGVM 148
292496226  79 QLVSVSVDYIMRDANYGWIIRSMHMGGASLFFALIYMHVARGVYFGAYLKNpHVWYSGLTLYLLSMGVGFLGYVLPWGVM 158
62161118  154 SYWGATVITNMLSVIPVVGESMLRYVWGGWTVCNATLKRFYTLHFLLPFVMVAVVFLHLFFLHEKGSNNPLGIESGTMCV 233
68989136  141 SYWGLTVITNMMTVVPG-GARALDWFQGGFVISSLTLKRVFVLHFILPFVILGLALVHVLILHQNGSSNPLGLDQEGINV 219
153123680 137 AYWAAQVISSMVTAVPVFGGDIAMWVWGGYAVGNITLKRLFSIHFLLPFVILGVFFLHLIFLHVTGSGNPLGLDSECNLV 216
7212447   108 SYWGLTVITNMMTVIPG-GARALDWFQGGFVISTVTLKRVFVLHFLLPFVILGLSLAHVLLLHVNGSSNPLGLDETNFSV 186
229324854 147 SYWGLTVITNMMTVIPG-GARALDWFQGGFVISTVTLKRVFVLHFLLPFVILGLSLAHVLLLHANGSSNPLGLDETNFSV 225
229324834 148 SYWGLTVITNMMTVIPG-GARALDWFQGGFVISTVTLKRVFVLHFLLPFVILGLSLAHVLLLHVNGSSNPLGLDETNFSV 226
229328223 148 SYWGLTVITNMMTVIPG-GARALDWFQGGFVISDVTLKRVFILHFLLPFVILGLSLSHVLLLHMNGSSNPLGLDETEFSV 226
254033635 141 AYWAAQVISSMVTAVPVFGGDIAMWVWGGYAVGNITLKRLFSIHFLLPFVILGVFFLHLIFLHVTGSGNPLGLDSECNLV 220
281190778 149 SYWGLTVITNMMTVIPG-GARALDWFQGGFVITTVTLKRVFVLHFLLPFVILGFSLAHVLLLHMNGSSNPLGLDETNFSV 227
292496226 159 SYWGLTVITNMMTVIPG-GARALDWFQGGYVITSMTLKRVFVLHFLLPFVILGLSLTHVLFLHMNGSSNPLGLDETNFSV 237
62161118  234 PFHPFYTIKDLFGYVCFSFFFMYLVCVDPELLGNHLNYWPANPMKTPIHVQPEWYFMFAYAILRSIPHKAGGVYVMFLSI 313
68989136  220 PFHPYYSIKDLAGFAVLVAMLIGMAFTFASVTADPLQWQPINKMKTPAVIKPEWYFLYAYAILRSIPHKAGGVAMMFLAI 299
153123680 217 RFHSFFTVKDLVGVSGGLLIVVFMISFYPYSLLDGGSFIACDYMETPASIHPEWYFLFAYAILRSVPNKIGGIVLLLLSI 296
7212447   187 PFHPYYSIKDLAGFALLLAGLVGMTFTFASLTADPLQWQPINKMKTPAVIKPEWYFLYAYAILRSIPHKAGGVFTMFAAI 266
229324854 226 PFHPYYSIKDLAGFALLLAGLVGMTFTFASLTADPLQWQPINKMKTPAVIKPEWYFLYAYAILRSIPHKAGGVFTMFAAI 305
229324834 227 PFHPYYSIKDLAGFALLLAGLVGMTFTFASLTADPLQWQPINKMKTPAVIKPEWYFLYAYAILRSIPHKAGGVFTMFAAI 306
229328223 227 PFHPYYSIKDLAGFALLLAALVGITFTFASLTADPLQWQPVNKMKTPSVIKPEWYFLYAYAILRSIPHKAGGVSTMFAAI 306
254033635 221 RFHSFFTVKDLVGVSGGLLIVVFMISFYPYSLLDGGSFIACDYMETPASIHPEWYFLFAYAILRSVPNKIGGIVLLLLSI 300
281190778 228 PFHPYYSIKDLAGFALLLAGLVGMTFTFASLTADPLQWQPINKMKTPAVIKPEWYFLYAYAILRSIPHKAGGVFTMFAAI 307
292496226 238 PFHPYYSIKDLAGFVLLLIGFVGVTFTFASLTVDPLQWQPINKMKTPTVIKPEWYFLYAYAILRSIPHKAGGVFTMFAAI 317
62161118  314 VVLYLIPTL-HTGKYRSLCFYPLNQVVFWVLVGSFISLTWIGARPVREPYIILGSVFQLFISLVYCWTPFLygcEMNYLN 392
68989136  300 VGVAIMPLLsKTEQYQSMKASPVGRWIFFIWAANFCFLTIIGAQEPSGGWVLAGQFGTLFHLGCMAFIPLV---KLKWED 376
153123680 297 LVLFVLPEI-WCGKMEGFCFYPGCQFLFWTWIFNFIILTYVGSQGVDQPFVMAGEWGTIYYFLFFPLVGIM---QHLEDT 372
7212447   267 AGIAVFPMIsSNENFQSMKACPPARLMFVIWVANFMFLTVIGAQEPTGGWVLAGQFGTILHLSALVMIPMI---KADWEF 343
229324854 306 AGIAIFPMIsGNEKFQSMKACPPARLMFVIWVANFMFLTVIGAQEPTGGWVLAGQFGTILHLSALVMIPMI---KAEWEY 382
229324834 307 AGIAVFPMIsSNENFQSMKACPPARLMFVIWVANFMFLTVIGAQEPTGGWVLAGQLGTILHLSALVMIPMI---KAEWEF 383
229328223 307 VGVAVFPMIsGHEKFQSMKVCPPARFVFFLWVANFTFLTVIGAQEPAGGWVLAGQFGTFFHLSALVMIPMI---KEEWEW 383
254033635 301 LVLFVLPEI-WCGKMEGFCFYPGCQFLFWTWIFNFIILTYVGSQGVDQPFVMAGEWGTIYYFLFFPLVGIM---QHLEDT 376
281190778 308 VGIAVFPMIsGSEKFQSMKVCPPARLMFVIWAANFMFLTVIGAQEPAGGWVLAGQFGTILHLSMLVMIPMI---KAEWES 384
292496226 318 AGVAVFPMIsGPEKFQSMKVCPLVRLVFIIWAANFMFLTVIGAQEPTGGWVLAGQFSTVLHLGALVVIPAV---KMKWEM 394
62161118  393 TLNF 396
68989136  377 WIIK 380
153123680 373 FSKK 376
7212447   344 YLFM 347
229324854 383 HLYK 386
229324834 384 HLFK 387
229328223 384 HLYQ 387
254033635 377 FSKK 380
281190778 385 WLYA 388
292496226 395 ELYN 398
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap