Conserved Protein Domain Family
ND1

?
MTH00143: ND1 
NADH dehydrogenase subunit 1; Provisional
Statistics
?
PSSM-Id: 177201
View PSSM: MTH00143
Aligned: 73 rows
Threshold Bit Score: 339.154
Threshold Setting Gi: 115531642
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
71657929    1 MVVLVWSVGFYVSVLLSVAYFTLFERKVLAASQGRKGPMMVGWLGVLQPFADGIKLFSKEYFTPSDSNHLLFFLGPCFML 80 
68989144    3 LCLLSISVLVYLGVLLSVAYFTLMERKCLSSMGVRLGPDKTSVGGFAQPVTDGAKLLTKEFVAPSNAVKIIFLLVPCVSL 82 
62161120    3 WVAVIVSIIPFVGVLLAVGFYTLLERKILAIIMIRKGPSKVSYMGILQPFSDAGKLLCKEFIVPTRANVGPFILAPALML 82 
46369498    3 WQLFFNIIFIYLGVLVSVAYFTLMERKCLSSLGIRLGPDKISFAGLAQPISDGMKLFTKEFVAPSNSAKLGFFLIPCVAM 82 
51830032    3 WVAVIVSIIPFVGVLLAVGFYTLLERKILAIIMIRKGPSKVSYMGILQPFSDAGKLLCKEFIVPTRANVGPFILAPALML 82 
229324842   3 SYLFFNIIFIYLGVLVSVAYFTLMERKCLSSLGIRLGPDKISFAGLAQPISDGMKLFTKEFVAPSNSAKLGFFLIPCVAM 82 
229328229   3 SCLFFTTLLIYLGVLLSVAYFTLMERKCLSSLGIRLGPDKISFGGFGQPISDGMKLFTKEFVPPSNSAKIVFFLVPCVSL 82 
229324861   3 SCLFFTIIFTYLGVLLSVAYFTLMERKCLSSLGIRLGPDKISFAGIAQPVSDGMKLFTKEFVAPSNSAKLGFFLIPCVAM 82 
281190785   3 SCLFFTTILIYLGVLLSVAYFTLMERKCLSSLGIRLGPDKISLGGLAQPISDGMKLFTKEFVPPSNSAKIVFFLVPCVSL 82 
292496233   3 MSLVFSTLFIYLGILLSVAYFTLMERKCLSSLGVRLGPDKISFAGFAQPISDGMKLFTKEFVAPGNSVKIIFFLIPCVSL 82 
71657929   81 FHSFVLWGCSMGVWsCGIYFFWGGLYVLSVLSVGVYGVVLCGWSSNSKYAMFGAVRALAQVISYEVMLVLLYLPPFFVSR 160
68989144   83 FLCFVGWQIFPSSS-LSSSSSNDLLFFLVVSSLNAHVAIMSGWSSTSKYAGVGGVRGFAQIISYEICMSIILVVVVFFSL 161
62161120   83 AISLLGWLLYPYKS-AEVFYVFGVILFMVITSVSVYGVMMSGWASNSKYSLLGAVRAMAQSISYEIPMGFIFFCVVLCSG 161
46369498   83 LLCFLGWQIYPCSS-TSPSMGNDILFFLVVSSVNAHVAIMSGWTSSSKYASVGGVRGFAQVISYEICLSITLVAVMFFSG 161
51830032   83 AISLLGWLLYPYKS-AEVFYVFGVILFMVITSVSVYGVMMSGWASNSKYSLLGAVRAMAQSISYEIPMGFIFFCVVLCSG 161
229324842  83 LLCFLGWQIFPCSS-TSPSMGNDILFFLVVSSVNAHVAIMSGWTSSSKYASVGGVRGFAQVISYEICLSITLVAVMFFSG 161
229328229  83 LLCFLGWQIFPCSS-VSPSMGNDILFFLVVSSVNAHVAIMSGWSSSSKYASVGGVRGFAQVISYEICLSITLVAVMFFSG 161
229324861  83 LLCFLGWQIFPCNS-TSPSMSNDILFFLVVSSVNAHVAIMSGWTSSSKYASVGGVRGFAQVISYEICLSITLVAVMFFSG 161
281190785  83 LLCFLGWQIFPCNS-VSPGMGNDILFFLVVSSVNAHIAIMSGWSSSSKYASVGGVRGFAQVISYEICLSITLVAVMFFSG 161
292496233  83 MLCFMGWQIFPSIG-ASSSMSSDMLFFLIVSSLNAHIAIMSGWSSTSKYASVGSVRGFAQVISYEICLSITLVAVMFFSM 161
71657929  161 SLEFQEVSFAQLSGMNGGVLF-LVFPWWMFCILAESNRAPFDFVEGESELVSGFNVEYGGPGFAMIFIAEYSNVIFLSQL 239
68989144  162 GMSYCALSETGWSVWWCLYCL-PVALMWLTVCLAEANRAPFDLVEAESELVSGFNIEFSAGSFAALFIAEYGMILLMSMV 240
62161120  162 VFMFQEISVFQQSLFFFFLPLcVVMLVWMLCMLAETNRAPFDFVEGESELVSGYNVEYSGGGFAVMFIAEYSSILLSSVM 241
46369498  162 SMSFFSLSDSGWSMWWGLYCA-PVAALWVVICLAEANRAPFDLVEAESELVSGFNTEFSAGSFAGLFIAEYGMILLMCLV 240
51830032  162 VFMFQEISVFQQSLFFFFLPLcVVMLVWMLCMLAETNRAPFDFVEGESELVSGYNVEYSGGGFAVMFIAEYSSILLSSVM 241
229324842 162 SMSFFSLSDSGWSVWWGLYCA-PVAALWVVICLAEANRAPFDLVEAESELVSGFNTEFSAGSFAGLFIAEYGMILLMCLV 240
229328229 162 SMSFFVLSDSGWSAWWGFYCM-PVAALWVTICLAEANRAPFDLVEAESELVSGFNTEFSAGSFAGLFIAEYGMILLMCLV 240
229324861 162 GMSFFSLSDSGWSAWWGFYCA-PVAALWVVICLAEANRAPFDLVEAESELVSGFNTEFSAGSFAGLFIAEYGMILLMCLV 240
281190785 162 GMSFFSLSDSGWSSWWSLYCL-PVAALWVTICLAEANRAPFDLVEAESELVSGFNTEFSAGSFAGLFIAEYGMILLMCLV 240
292496233 162 GMSFFSLSDSGWSAWWSLYCV-PVAVLWMIICLAEANRAPFDLVEAESELVSGFNVEFSAGSFAALFIAEYGMILLMCMV 240
71657929  240 TGVMFFGGWSFFrcgsqyeVLGNGVFSSLFGFLVVFLVVLCRSSFPRYRYDLLMKLVWCRVLPILMGGFACFLLVL 315
68989144  241 TVVSFFQNPGAW-------TLAGGTWMFVKMSLFVFFFVWSRAAFPRFRYDQLMLMAWKSLLPFALAIYCGFFVMA 309
62161120  242 SAAMFFGGNEAL--------------VGFFMMVFAIFFVVVRASLPRLRYDKLMNLCWTVLLCVMLTASVCVVVLV 303
46369498  241 TVWSFFQNTCVW-------TVLGSVWMFTKILMFTFFFIWTRASFPRFRYDQLMMAAWKTLLPFVLGIYCVFFFIM 309
51830032  242 SAAMFFGGNEAL--------------VGFFMMVFAIFFVVVRASLPRLRYDKLMNLCWTVLLCVMLTASVCVVVLV 303
229324842 241 TVWSFFQNTCVW-------TVLGSVWMFTKILMFTFFFIWTRASFPRFRYDQLMMAAWKTLLPFVLSIYCVFFFIM 309
229328229 241 TVWSFFQNSCVW-------TVLGSVWMFTKVVIFAYFFVWTRASFPRFRYDQLMMAAWKSLLPFVLGVYCLFFFIL 309
229324861 241 TVWSFFQNSCVW-------TVLGSVWMFTKVLMFAFFFIWTRASFPRFRYDQLMMAAWKTLLPFVLGIYCVFFFIT 309
281190785 241 TVWSFFQNACTW-------TVLGSVWMFMKVGIFAFFFIWTRATFPRFRYDQLMMAAWKSLLPFILGIYCVFFFIT 309
292496233 241 TVWSFFQHSAVW-------TVLGTVWMFTKIGLLTFFFIWVRATFPRFRYDQLMMAAWKSLLPLTLGIYCLFFILA 309
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap