Conserved Protein Domain Family
COX3

?
MTH00141: COX3 
cytochrome c oxidase subunit III; Provisional
Statistics
?
PSSM-Id: 177199
View PSSM: MTH00141
Aligned: 78 rows
Threshold Bit Score: 288.713
Threshold Setting Gi: 18249932
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
238908493   1 MARTGYQLLGPSPWPVTAAIAVLGLCSTLLIFVCEGaSwnfWVSFVICFGLLITIMANWWSDVVKESTYLGQWSSYVLRT 80 
153123683   1 MKRCPFHRVDQSPWPLLTAWSLGISAMMFVQFLHGD-P---FYRVLVGLGLVVTCVYWWFSDIISEATFMGKHTRRVQRG 76 
168487813   2 PGRTPYHVVDPSPWPVLMGICLWSVAVTFISWVYYI-P---IQKPHVILGMLVLTSFGWIRDIIMESTFQGFHTEKVQSG 77 
170675694  33 VVRTPYHVVDPSPWPMIMGANLWGVAAMFICWVNEI-S---LDSLYWGIPLFVLTFYSWVRDIINEATFQGFHTEKVQSG 108
229328222  29 IIRTPYHVVDPSPWPMIMGANLWGIAAMFICWVNQI-S---FDNLYWGIPLLVFTTYNWVRDIINEATFQGFHTEKVQSG 104
229324853  33 VVRTPYHVVDPSPWPMIMGANLWGVAAMFICWVNQI-S---LDSLYWGIPLFVLTFYSWVRDIINEATFQGFHTEKVQSG 108
229324833  33 VVRTPYHVVDPSPWPMIMGANLWGVAAMFICWVNEI-S---LDSLYWGIPLFVLTFYSWVRDIINEATFQGFHTEKVQSG 108
254033638   1 MKRCPFHRVDQSPWPLLTAWSLGISAMMFVQFLHGD-P---FYRVLVGLGLVVTCVYWWFSDIISEATFMGKHTRRVQRG 76 
281190777  29 IVRTPYHVVDPSPWPMIMGANLWGVAAMFICWVNQI-S---FDNLYWGIPLFVLTFYSWVRDIINEATFQGFHTEKVQSG 104
292496225  28 AVRTPYHVVDPSPWPMLMGANLWGIAAMFICWVNQI-S---FDNLYWGVPLFVLTCYSWVRDIIAEATYQGFHTEKVQSG 103
238908493  81 YVWGFRLFIISEVFFFAGLLGAFVYCAVGESSIHGvGFWPPrGIKPLSPGKMALLNTAVLLGSSVTANWALCCVKAHNcl 160
153123683  77 IRIGFCMFLISETMFFASFFWAFFHSALAPGVALG-FFWPQ-EVYTMPCWGLPLLNTSLLLSTVFPCNMAQAAIKAGE-- 152
168487813  78 LTLGFILFLVSELMLFFSFFWAFFHMALSPSIEIG-GCWPPaGLHCLDWSGTPLHNTALLVMSSGSISSAHHFFMDGE-- 154
170675694 109 LTLGFILFLISELMLFFSFFWAFFHSALSSSVEIG-CCWPPvGLECLDWSKVPLHNTALLVASSASITLSHNYLQWGD-- 185
229328222 105 LTLCFILFLISELMLFFSFFWAFFHSALSSSVEIG-CCWPPvGLECLDWSKVPLHNTALLVASSASITLSHHYLQSGD-- 181
229324853 109 LTLGFILFLISELMLFFSFFWAFFHSALSSSVEIG-CCWPPvGLECLDWSKVPLHNTALLVASSASITLSHHYLQWGD-- 185
229324833 109 LTLGFILFLISELMLFFSFFWAFFHSALSSSVEIG-CCWPPvGLECLDWSKVPLHNTALLVASSASITLSHNYLQWGD-- 185
254033638  77 IRIGFCMFLISETMFFASFFWAFFHSALAPGVALG-FFWPQ-EVYTMPCWGLPLLNTSLLLSTVFPCNMAQAAIKAGE-- 152
281190777 105 LTLGFILFLISELMLFFSFFWAFFHSALSSSVEIG-CCWPPvGLECLDWSKVPLHNTALLVASSASITLSHHYLQWGD-- 181
292496225 104 LTLGFILFLISELMLFFSFFWAFFHSALSSSVEVG-CCWPPvGLECLDWSKVPLHNTALLVASSMTITLSHLYLQREV-- 180
238908493 161 nfnmsvplsvltpsgksvkgvkknvdtffYQeSGLVALMVTICLGLCFTYLQALEYYWASFSFGDGIYGSSFFLLTGFHG 240
153123683 153 -----------------------------LK-IALNTLGLVMILGGCFVLVQGYEIFTAKFTLADGVYGCCFFSLTGLHG 202
168487813 155 -----------------------------WEfGLGVSYYLTLYLSYLFIENQYMEYMWLPFTIADGVYGSCFFMLTGLHG 205
170675694 186 -----------------------------IW-VATATYIATLGLSVMFIKNQYEEYAWSSFSISDGVYGSCFFMLTGLHG 235
229328222 182 -----------------------------IW-LSVVTYVGTLGLSVMFIKNQYEEYAWSSFSISDGVYGSCFFMLTGLHG 231
229324853 186 -----------------------------IW-VAAATYIATLGLSVMFIKNQYEEYAWSSFSISDGVYGSCFFMLTGLHG 235
229324833 186 -----------------------------IW-VAAATYIATLGLSVMFIKNQYEEYAWSSFSISDGVYGSCFFMLTGLHG 235
254033638 153 -----------------------------LK-IALNTLGLVMILGGCFVLVQGYEIFTAKFTLADGVYGCCFFSLTGLHG 202
281190777 182 -----------------------------IW-LAAATYIATLGLSVMFIKNQYEEYAWSSFSISDGVYGSCFFMLTGLHG 231
292496225 181 -----------------------------IC-LSVVTYVMTLGLSVLFIKNQYEEYAWSNFSISDGVYGSCFFMLTGLHG 230
238908493 241 LHVIIGTIFLVVCWFRLLNFHFSFNHfYFGMWAAVWYWHFVDIVWVFVYGMVYiwgYWGY 300
153123683 203 LHVVGGLFFLFIAWSRARLGHFSSSR-HLNLTFSIWYWHFVDIIWIFVFSFIY---VWSN 258
168487813 206 LHVIAGTCGLLFCGARILLMQFSDTH-HVALTLAIWYWHFVDVVWLALFFIIY---VWGS 261
170675694 236 LHVIGGTCGLLFCFVRMMLLQFSSEH-HVALTLAIWYWHFVDIVWLGLFFIIY---IWGS 291
229328222 232 MHVIGGTCGLLFCLVRMMLLQFSTEH-HIALTLAIWYWHFVDIVWLGLFFIIY---IWGS 287
229324853 236 LHVIGGTCGLLFCFVRMMFLQFSSEH-HVALTLAIWYWHFVDIVWLGLFFIIY---IWGS 291
229324833 236 LHVIGGTCGLVFCFVRMMLLQFSSEH-HVALTLAIWYWHFVDIVWLGLFFIIY---IWGS 291
254033638 203 LHVVGGLFFLFIAWSRARLGHFSSSR-HLNLTFSIWYWHFVDIIWIFVFSFIY---VWSN 258
281190777 232 LHVIGGTCGLLFCFIRMMLLQFSSEH-HVALTLAIWYWHFVDIVWLGLFFIIY---IWGS 287
292496225 231 MHVIGGTCGLLFCFVRLLSLQFSPEH-HVALTLAIWYWHFVDIVWLGLFFIIY---IWGS 286
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap