Conserved Protein Domain Family
ND6

?
MTH00138: ND6 
NADH dehydrogenase subunit 6; Provisional
Statistics
?
PSSM-Id: 177196
View PSSM: MTH00138
Aligned: 495 rows
Threshold Bit Score: 134.883
Threshold Setting Gi: 215979551
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
167716862   1 MTYFMFLLLVALVVGLVAVASNPTPYFAALGLVVAAGVGCGILVGYGGSFLSLVLFLIYLGGMLVVFAYSAALAAEPFPE 80 
16357260    1 MFYMMMMMMVGFVLGAAALASNPSPVYAVLGLVLMAGMACMILINSGGPFLSLLFFLVYLGGMLVVFAHCVALAAERYPK 80 
215979551   1 MFYALVFLLLGMLVVMIVLSTNPAPFYGVFNLVLVALLCCGASVLHGGTFLSLVLLMIYMGGMLVVFIYSSALSADKDPK 80 
215979635   1 MFYALVFLLLGMLVVMIVLSTNPAPFYGVFNLVLVALLCCGASVLHGGTFLSLVLLMIYMGGMLVVFIYSSALSADKDPK 80 
215979649   1 MFYALVFLLLGMLVVMIVLSTNPAPFYGVFNLVLVALLCCGASVLHGGTFLPLVLLMIYMGGMLVVFIYSSALSANKDPK 80 
215979705   1 MFYALVFLLLGMLVVMIVLSTNPAPFYGVFNLVLVALLCCGASVLHGGTFLSLVLLMIYMGGMLVVFIYSSALSADKDPK 80 
215979733   1 MFYALVFLLLGMLVVMIVLSTNPAPFYGVFNLVLVALLCCGASVLHGGTFLSLVLLMIYMGGMLVVFIYSSALSADKDPK 80 
215979747   1 MFYALVFLLLGMLVVMIVLSTNPAPFYGVFNLVLVALLCCGASVLHGGTFLSLVLLMIYMGGMLVVFIYSSALSADKDPK 80 
215979761   1 MFYALVFLLLGMLVVMIVLSTNPAPFYGVFNLVLVALLCCGASVLHGGTFLSLVLLMIYMGGMLVVFIYSSALSADKDPE 80 
255764530   1 MFYALVFLLLGMLVVMIVLSTNPAPFYGVFNLVLVALLCCGASVLHGGTFLSLVLLMIYMGGMLVVFIYSSALSADKDPK 80 
167716862  81 AWGSRSVAGYVLVYLLGV--------VLAAGLFWGGWYEGSWVVVDGLKEFSMLRGDVSGVAVMYSFGGAMLVICAWVLL 152
16357260   81 AWGDVIFLGALVGVVVGY--------SVAVIVGWVNWFGVGSESGYDFDDYSFICPEGEGLGLLYDKGGWLLLFCVIILL 152
215979551  81 APTGWQVVLFFFGYFFFVfgilytnmVLDEKVWWGVSGKMDW--------NAVFRGDMDGVSLMYSSGGGVLLLGAWVLL 152
215979635  81 APTGWQVVLFFFGYFFFVfgilytnmVLDEKVWWGVSGEMDW--------DAVFRGDMDGVSLMYSSGGGVLLLGAWVLL 152
215979649  81 APTGWQVVLFFFGYFFFVfgilytnmVLDEEVWWGVSGEMDW--------DAVFRGDMDGVSLMYSSGGGVLLLGAWVLL 152
215979705  81 APTGWQVVLFFFGYFFFVfgilytnmVLDEEVWWGVSGEVDW--------DAVFRGDMDGVSLMYSSGGGVLLLGAWVLL 152
215979733  81 APTGWQVVLFFFGYFFFVfgilytnmVLDEEIWWGVSGEMDW--------DAVFRGDMDGVSLMYSSGGGVLLLGAWVLL 152
215979747  81 APTGWQVVLFFFGYFFFVfgilytnmVLDEEVWWGVSGEMDW--------DAVFRGDMDGVSLMYSSGGGVLLLGAWVLL 152
215979761  81 APTGWQVVLFFFGYFFFVfgilstntVLDEELWWGVSGELDW--------DAVFRGDMDGVSLMYSSGGGVLLLGAWVLL 152
255764530  81 APTGWQVVLFFFGYFFFVfgilytnmVLDEEVWWGVSGEMDW--------DAVFRGDMDGVSLMYSSGGGVLLLGAWVLL 152
167716862 153 LTLLVVLELTRGLSRGTLRAV 173
16357260  153 VVLVVVLELTRGRSQGALRAI 173
215979551 153 LTLLVVLELVRGLGRGALRAV 173
215979635 153 LTLLVVLELVRGLGRGALRAV 173
215979649 153 LTLLVVLELVRGLGRGALRAV 173
215979705 153 LTLLVVLELVRGLGRGALRAV 173
215979733 153 LTLLVVLELVRGLGRGALRAV 173
215979747 153 LTLFVVLELVRGLGRGALRAV 173
215979761 153 LTLFVVLELVRGRDRGALRAV 173
255764530 153 LTLLVVLELVRGLGRGALRAV 173
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap