Conserved Protein Domain Family
ND3

?
MTH00136: ND3 
NADH dehydrogenase subunit 3; Provisional
Statistics
?
PSSM-Id: 177194
View PSSM: MTH00136
Aligned: 455 rows
Threshold Bit Score: 135.817
Threshold Setting Gi: 108793400
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
51235012    1 MNLIMTILTITAALSLILATISFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILFLLFDLEIALLLPLPWGD 80 
45388051    1 MNPIISTIMITTALSCILITVSFWLPQMNPDSEKLSPYECGFDPIGSARLPFSMRFFLVAILFLLFDLEIALLLPLPWGD 80 
45388037    1 MNPIISVFMITIALSCILITISFWLPQMNPDSEKLSPYECGFDPLGSARLPFSMRFFLVAILFLLFDLEIALLLPLPWGD 80 
280978063   1 MNPTISILMVTTTLSCILVTISFWLPQMSPNSEKLSPYECGFDPLGSARLPFSMRFFLVAILFLLFDLEIALLLPLPWGA 80 
280978287   1 MNPVISTLMITTALSCILIIVSFWLPQMNPDSEKLSPYECGFDPLGSARLPFSMRFFLVAILFLLFDLEIALLLPIPWGD 80 
280978329   1 MNPIISILMITSTLSCILIVVSFWLPQMNPDSEKLSPYECGFDPLGSARLPFSMRFFLVAILFLLFDLEIALLLPLPWGD 80 
280978343   1 MNPTISVLMITTALSCILVTISFWLPQMNPNSEKLSPYECGFDPLGSARLPFSMRFFLVAILFLLFDLEIALLLPLPWGN 80 
280978441   1 MNPIISTMLITAALSCVLMVVSFWLPQMNPDSEKLSPYECGFDPLGSARLPFSMRFFLVAILFLLFDLEIALLLPLPWGD 80 
280978511   1 MNPIISVFMITIALSCILITISFWLPQMNPDSEKLSPYECGFDPLGSARLPFSMRFFLVAILFLLFDLEIALLLPLPWGD 80 
280978525   1 MNPILSTISITMALSCILMTISFWLPQMNPDLEKLSPYECGFDPIGSARLPFSMRFFLVAILFLLFDLEIALLLPLPWGD 80 
51235012   81 QLNNPTGTFFWATTVLILLTLGLIYEWTQGGLEWAE 116
45388051   81 QLPDAIQTLFWAMFILILLTAGLIYEWIQGGLEWAE 116
45388037   81 QLPDPAQTFFWATSILVLLTLGLAYEWAQGGLEWAE 116
280978063  81 QLPDIYQTFFWATSIIILLTLGLTYEWLQGGLEWAE 116
280978287  81 QLPDPAQTFFWATSILVLLTLGLVYEWIQGGLEWAE 116
280978329  81 QLPEATQTFFWAMSILILLTLGLVYEWIQGGLEWAE 116
280978343  81 QLPDINQTFFWATAIIILLTLGLMYEWLQGGLEWAE 116
280978441  81 QLPDATQTFFWATTILILLTLGLIYEWIQGGLEWAE 116
280978511  81 QLPDPAQTFFWATSILVLLTLGLAYEWAQGGLEWAE 116
280978525  81 QLPDVTQTLFWAMFILILLTAGLIYEWVQGGLEWAE 116
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap