Conserved Protein Domain Family
ND2

?
MTH00135: ND2 
NADH dehydrogenase subunit 2; Provisional
Statistics
?
PSSM-Id: 177193
View PSSM: MTH00135
Aligned: 514 rows
Threshold Bit Score: 371.83
Threshold Setting Gi: 16357250
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
148922812   1 MNPYVLTILLFSLGLGTTLTFASSHWLLAWMGLEINTLAIIPLMAHQHHPRAVEATTKYFLTQATAAAMILFASTTNAWI 80 
25057422    1 MSPYILFIMLMSLGLGTTLTFASSNWFLAWMGLEINTLAIIPLMARHHHPRAVEAATKYFITQAAAAALLLFAGLMNAWQ 80 
109689681   2 VAPSIMTFFLLALGLGTSVTFCSSHWLMAWMGLEINSLAILPLMVSSHQARAIEASVKYLLIQATGAGIILWGSMLNAQA 81 
38639884    1 MSPYILFVMLTSLGLGTTLTFTSSHWLLAWMGLEINTLAIIPLMTNKHHPRAVEAATKYFLTQAAAAAILLFASIYNAWY 80 
5835319     1 MNPYILSIMLISLGLGTTLTFASSNWLLAWMGLEINTLAIIPLMANNHHPRAVEAATKYFITQAAAAALLLFSSLINAWQ 80 
12248166    1 MHPFVLTCLLSALGLGTVLTFSSTHWLMAWMGLEINTLAILPVMAQKHHPRGIEAATKYFLTQATAAAVILFAGLTNAWL 80 
16356983    1 MHPLITFCFLSTLGLGTVLAFSSSHWFLAWMGLELNTLAILPLMAQKHHPRAVEATTKYFLIQATAAAVVLFAALTNAWL 80 
16357446    1 MSPMILTLFLLSLGLGTTITFASSHWLLAWMGLEINTLAILPLMAQHPHPRAVEATTKYFLTQATAAAMILFASATNAWY 80 
16357208    1 MSPFILSLFLLSLGLGTTITFSSSHWLLAWMGLEINTLAIMPLMAQRPHPRAVEATTKYFLTQATAAAMILFASATNAWV 80 
28894782    1 MNPYVLSLLISALGLGTALTFSSSHWLLAWMGLEVNTLAIIPLMTQKHSPRSVEAAAKYFLTQAAAAATIMFASATNAWL 80 
148922812  81 SGQWEVTQLTNPIACTIAVTALALKIGLAPTHFWLPEVLQGITLTTGLILSTWQKLAPFALILQVAENaHPYLLTALAIC 160
25057422   81 SGQWIIQDMSMP-TSALMTLAIAIKLGVAPMHFWLPEVMQGITLNTGLILATWQKLAPLALLYQISNNlMPELMIILGLT 159
109689681  82 TGHWDILSSKEDLAMLIIISGLALKLGLAPLHAWLPEVIQGTDMTTAMILSTWQKLAPFILMCEVSSS-HQWLALTLGLI 160
38639884   81 SGQWFIQDMSSPV-STLMTLAIAIKLGIAPMHFWLPEVMQGISINTGLILVTWQKLAPLALLMQISHNiKPELLIILGLM 159
5835319    81 SGQWMIQDMSMPM-SALMTIAIAIKLGVAPVHFWLPEVMQGIKLNTGLILATWQKLAPLALLYQISNNlMPELMIALGLM 159
12248166   81 TGEWSISQLSHPLAANLMFLALALKVGLAPMHFWLPEVLQGLDLTTGLILSTWQKLAPFALLVQVAPSvDPSLLVALSLL 160
16356983   81 TGEWLILQLSHPAPATLTLLALSLKVGLAPVHFWLPEVLQGLDLTTGLILSTWQKLAPFALIVQTAPStDPRLLITLGLA 160
16357446   81 TGEWCITDMSSPLSMTMVIMALALKLGLAPVHFWLPEVLQGLNLTTGLVLSTWQKLAPFILLIQIPLP-NHTLMTLLALL 159
16357208   81 TGEWNIMNMSSPLSATMAIMALSLKLGLAPVHFWLPEVLQGLDLTTGLILSTWQKLAPFILLVQMSPP-NNDLLIILALL 159
28894782   81 TGTWDILHLSHPFCATVAFMALALKLGLAPVHFWLPEVIQGVTLTTGLILSTWQKLAPFALILQVAPSvHHALVVSVGLA 160
148922812 161 STLVGGWGGLNQTQLRKILAYSSVAHLGWMILVAQMAPHMTLLALITYIIMTTAAFLTLEKVNSTKTITLASAWTKAPAL 240
25057422  160 STFIGGWGGLNQTQIRKIMAYSSIAHLGWIISIMHFMPTLAIINLIIYIIMTTTMFMTFNVTNSTSISTLAMNWSKFPTL 239
109689681 161 SIMVGGLSGINMTLMRKLLAYSSIAHLGWMMLVMTFNTHLALIALTIYIIATTMIFSTLNTTSASTINNLALSWGKYPAL 240
38639884  160 STIIGGWGGLNQTQIRKIMAYSSIAHLGWIISILHFMPALAMVNLFIYLIMTITMFMTFNLLNSPTINTLAVNWSKSPIL 239
5835319   160 STIVGGWGGLNQTQIRKIMAYSSIAHLGWIISIMHFMPSLAIINLIMYIIMTTTMFMIFNTLNSTTINALAINWSKFPAL 239
12248166  161 SILIGGWGGLNQTQLRKILAFSSIAHLGWMTLVMRFAPSLSILALLLYIVMTSATFLSMKTYGCTTLNGLATSWAKYPVL 240
16356983  161 STIIGGWGGLNQTQLRKVLAYSSIAHLGWMALILQFAPPIALLNLSLYITMTSMAFLALKAFNCTNLNNLATSWAKTPIL 240
16357446  160 SVLVGGWGGLNQVQTRKILAYSSIAHLGWMLLISQFSTPLALLALFTYILMTTPAFLILKFTHATTINSLASSWTKSVVL 239
16357208  160 SILVGGWGGLNQLQIRKILAYSSIAHLGWMLLVCQFSPPLSLLALFTYILMTTPAFLLLKFTSSLTINSLASAWTKSTVL 239
28894782  161 STFIGGWGGINQTQVRKLLAYSSVAHLGWMIIISQFSSSLSLLALSLYIVMTTSAFLTMKAGAASSLNTLAVSWSKTPTL 240
148922812 241 SALACLILLSLGGLPPLTGFMPKWLILQEVSNQGFPLTATVIALTALLSLYFYLRLTYAMTLTLAPYTTNSSTPWRTSTK 320
25057422  240 SAITMLALLSLGGLPPLSGFLPKWLILQELTNQGLMPTATMIALSALLSLYFYLRLSYSLTTTVTPNTHAQTLNWGTKT- 318
109689681 241 TALTPLILLSLGGLPPLSGFIPKWLIIQELVNQELILIAFVAAISALLSLYFYTRITYTLLCVTTPNYFGLAPFKFYRQK 320
38639884  240 AATSALALLSLGGLPPLSGFMPKWLIIQELTNQELAPTATLLALSALLSLFFYLRLSYSLSLTIMPNTHPQTLNWNMKIT 319
5835319   240 SAITMLALLSLGGLPPLSGFLPKWLILQELTNQNLALTATVMALSALLSLYFYLRLSYSLTTTIMPNTYQHMLNWNIKT- 318
12248166  241 GALLTPTLLSLGGLPPLSGFLPKWLIIDEMVKQGLQLPATLAALSALLSLYFYLRLCYAATLTSAPNVLTKVTPWRLVSP 320
16356983  241 AATLTPVLLSLGGLPPLSGFMPKWLVINEMVKQDLPLPATIAALSALLSLYFYLRVCYAMTLTSPPNTFIKVTPWRLLHP 320
16357446  240 TALTPLVLFSLGGLPPLSGFAPKWLILQELTKQGLPIVATLAAMMALLSLYFYLRLSYSLALTMAPNTPPASAPWRSIPQ 319
16357208  240 VATAPFILFSLGGLPPLSGFAPKWLILQELTKQDMPIIATMAAMMALLSLYFYLRVSYAAALTMAPNTPPASAPWRPSPT 319
28894782  241 IALASLTLLSLAGLPPLSGFMPKWLILQEMTKQGLPVLATLAALSALLSLFFYLRISYAMALTVSPNTVGASLSWRSSGN 320
148922812 321 SPTLPLAIAIMMATCLLPLTPSALALLA 348
25057422  319 KTSFILPVVMVMTITMLPISPSIISLF- 345
109689681 321 YVVFPIAILAIMTMMLLPTLPSLTAFFF 348
38639884  320 -TPLPLSLMMMMTLTMLPITPTIISLF- 345
5835319   319 KITFILPTMMIMTIAMLPISPSIISMF- 345
12248166  321 GGHLLLASLSTVALGTLPLAPTILAWIA 348
16356983  321 KIHFPLALASIAALGLLPVTPAILAWFT 348
16357446  320 QSSSLLAITTMMSILMLPIMPSTLSLFY 347
16357208  320 QSSLVLSLTTISSLFMLPLMPTALTLFC 347
28894782  321 HSTLLLASSTVMALGLLPLTPAFLSLYS 348
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap