Conserved Protein Domain Family
ND1

?
MTH00134: ND1 
NADH dehydrogenase subunit 1; Provisional
Statistics
?
PSSM-Id: 177192
View PSSM: MTH00134
Aligned: 475 rows
Threshold Bit Score: 555.757
Threshold Setting Gi: 280978056
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
161868005   1 MTNIVVSYILNPLIYMVPVLLAVAFLTLIERKVLGYMQLRKGPNIVGPYGLLQPIADGVKLFIKEPIRPSTSSPLLFVFA 80 
25057542    1 MITTLIIYIINPLTFIIPVLLAVAFLTLIERKVLGYMQLRKGPNIVGPYGLLQPIADGLKLFIKEPVRPSTSSPLLFLAT 80 
25057559    1 MITTLIIYIVNPLTFIIPVLLAVAFLTLIERKVLGYMQLRKGPNIVGPYGLLQPIADGLKLFIKEPVRPSTSSPLLFLAT 80 
25057601    1 MTSTLLIYIINPLTFIVPVLLAVAFLTLLERKVLGYMQLRKGPNIVGPYGLLQPIADGVKLFIKEPVRPSTSSPLLFLAT 80 
289183036   1 MTSTLLIYIINPLTFIVPVLLAVAFLTLLERKVLGYMQLRKGPNIVGPYGLLQPIADGVKLFIKEPVRPSTSSPLLFLAT 80 
289183050   1 MTSALLIYIINPLTFIVPVLLAVAFLTLLERKVLGYMQLRKGPNIVGPYGLLQPIADGVKLFIKEPVRPSTSSPLLFLAT 80 
289183064   1 MTSALLIYIINPLTFIVPVLLAVAFLTLLERKVLGYMQLRKGPNIVGPYGLLQPIADGVKLFIKEPVRPSTSSPLLFLAT 80 
289183078   1 MTSTLLIYLINPLTFIVPVLLAVAFLTLLERKVLGYMQLRKGPNIVGPYGLLQPIADGVKLFIKEPVRPSTSSPLLFLIT 80 
289183092   1 MTSTLLIYLINPLTFIVPVLLAVAFLTLLERKVLGYMQLRKGPNIVGPYGLLQPIADGVKLFIKEPVRPSTSSPLLFLIT 80 
289183274   1 MITTLIIYIVNPLTFIIPVLLAVAFLTLLERKVLGYMQLRKGPNIVGPYGLLQPIADGLKLFIKEPVRPSTSSPLLFLAT 80 
161868005  81 PVLALTLALTLWAPMPMPFPVADLNLSILFVLALSSLAVYSILGSGWASNSKYALVGALRAVAQTISYEVSLGLILLSVI 160
25057542   81 PMLALTLALTLWSPLPLPYPVIDLNLGILFILALSSLAVYSILGAGWASNSKYALIGALRAVAQTISYEVSLGLILLSAI 160
25057559   81 PMLALTLALTLWSPLPLPYPVIDLNLGILFILALSSLAVYSILGSGWASNSKYALIGALRAVAQTISYEVSLGLILLSAI 160
25057601   81 PMLALTLALTLWAPMPLPYPVIDLNLGILFVLALSSLAVYSILGSGWASNSKYALIGALRAVAQTISYEVSLGLILLSTI 160
289183036  81 PMLALTLALTLWAPMPLPYPVIDLNLGILFVLALSSLAVYSILGSGWASNSKYALIGALRAVAQTISYEVSLGLILLSTI 160
289183050  81 PMLALTLALTLWAPMPLPYPVIDLNLGILFVLALSSLAVYSILGSGWASNSKYALIGALRAVAQTISYEVSLGLILLSTI 160
289183064  81 PMLALTLALTLWAPMPLPYPVIDLNLGILFVLALSSLAVYSILGSGWASNSKYALIGALRAVAQTISYEVSLGLILLSTI 160
289183078  81 PMLALTLALTLWAPMPLPYPVIDLNLGILFILALSSLAVYSILGSGWASNSKYALIGALRAVAQTISYEVSLGLILLSTI 160
289183092  81 PMLALTLALTLWAPMPLPYPVIDLNLGILFILALSSLAVYSILGSGWASNSKYALIGALRAVAQTISYEVSLGLILLSTI 160
289183274  81 PMLALTLALTLWSPLPLPYPVIDLNLGILFILALSSLAVYSILGSGWASNSKYALIGALRAVAQTISYEVSLGLILLSAI 160
161868005 161 IFSGGFTLQTFSTTQEATWLVLPAWPLAAMWYISTLAETNRAPFDLTEGESELVSGFNVEYAGGPFALFFLAEYANILLM 240
25057542  161 IFTGGFTLQTFSTAQEAVWLIMPTWPLAAMWYISTLAETNRAPFDLTEGESELVSGFNVEYAGGPFALFFLAEYANILLM 240
25057559  161 IFTGGFTLQTFSTAQEAVWLIMPAWPLAAMWYISTLAETNRAPFDLTEGESELVSGFNVEYAGGPFALFFLAEYANILLM 240
25057601  161 IFAGGFTLQTFNTAQEAIWLVLPAWPLAAMWYISTLAETNRAPFDLTEGESELVSGFNVEYAGGPFALFFLAEYANILLM 240
289183036 161 IFAGGFTLQTFNTAQEAIWLVLPAWPLAAMWYISTLAETNRAPFDLTEGESELVSGFNVEYAGGPFALFFLAEYANILLM 240
289183050 161 IFTGGFTLQTFNTAQETIWLILPAWPLAAMWYISTLAETNRAPFDLTEGESELVSGFNVEYAGGPFALFFLAEYANILLM 240
289183064 161 IFTGGFTLQTFNTAQETIWLILPAWPLAAMWYISTLAETNRAPFDLTEGESELVSGFNVEYAGGPFALFFLAEYANILLM 240
289183078 161 IFTGGFTLQAFNTTQEAIWLILPAWPLAAMWYISTLAETNRAPFDLTEGESELVSGFNVEYAGGPFALFFLAEYANILLM 240
289183092 161 IFTGGFTLQAFNTTQEAIWLILPAWPLAAMWYISTLAETNRAPFDLTEGESELVSGFNVEYAGGPFALFFLAEYANILLM 240
289183274 161 IFTGGFTLQTFSTAQEAVWLIMPAWPLAAMWYISTLAETNRAPFDLTEGESELVSGFNVEYAGGPFALFFLAEYANILLM 240
161868005 241 NTLSAVLFLGSSYSTTMPEFTSLTLMTKAALLSMVFLWVRASYPRFRYDQLMHLVWKNFLPLTLALVIWHLSLSTAWAGL 320
25057542  241 NTLSTALFLGAYHVPTTPELTTINLMIKAALLSVVFLWVRASYPRFRYDQLMHLIWKNFLPLTLALVIWHLSLPVTLAGL 320
25057559  241 NTLSATLFLGAYHLPTTPELTTINLMIKAALLSVVFLWVRASYPRFRYDQLMHLIWKNFLPLTLALIIWHLSLPITLAGL 320
25057601  241 NTLSATLFLGASHMPTIPELTAINLMSKAALLSTMFLWVRASYPRFRYDQLMHLIWKNFLPLTLALIIWHLSLPIALTGV 320
289183036 241 NTLSATLFLGASHMPTIPELTAVNLMSKAALLSVMFLWVRASYPRFRYDQLMHLIWKNFLPLTLALIIWHLSLPIALTGV 320
289183050 241 NTLSATLFLGASHMPAIPELTAVNLMTKAALLSIMFLWVRASYPRFRYDQLMHLIWKNFLPLTLALIIWHLSLPIALTGL 320
289183064 241 NTLSATLFLGASHMPAIPELTAINLMTKAALLSIMFLWVRASYPRFRYDQLMHLIWKNFLPLTLALIIWHLSLPIALTGL 320
289183078 241 NTLSATLFMGASHIPTIPELTAMNLMTKAALLSIMFLWVRASYPRFRYDQLMHLIWKNFLPLTLAFIIWHMSLPIALTGL 320
289183092 241 NTLSATLFMGASHIPTIPELTAVNLMTKAALLSIMFLWVRASYPRFRYDQLMHLIWKNFLPLTLAFIIWHMSLPIALTGL 320
289183274 241 NTLSATLFLGAYHVPTTPELTTINLMIKAALLSVVFLWVRASYPRFRYDQLMHLIWKNFLPLTLALIIWHLSLPITLAGL 320
161868005 321 PPHA 324
25057542  321 PPQL 324
25057559  321 PPQL 324
25057601  321 PPQP 324
289183036 321 PPQP 324
289183050 321 PPQP 324
289183064 321 PPQP 324
289183078 321 PPQP 324
289183092 321 PPQP 324
289183274 321 PPQL 324
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap