Conserved Protein Domain Family
ATP6

?
MTH00132: ATP6 
ATP synthase F0 subunit 6; Provisional
Statistics
?
PSSM-Id: 177190
View PSSM: MTH00132
Aligned: 473 rows
Threshold Bit Score: 265.198
Threshold Setting Gi: 209664433
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
51235010    1 MMVSFFDQFASPSYLGIPLIAIAIALPWVLYPTSSSRWINNRLITIQGWFINRFTNQLMLPLNVGGHKWALLLASLMIFL 80 
25057533    1 MTLSLFDQFASPTLLAVPLVILAMLAPWDMFPAPGVQWLGSRLLAIQSWVFKTVTRQMIMPMSVAGHKWALLLMSLLIFL 80 
25057458    1 MNLTLFDQFASPTLMGIPLVVIATLAPWTLYPALPGHWLKTRLGALLSSAFKSVAQQIVLPIPEKGHKWSALFVSLLVLL 80 
25057476    1 MILNLFDQFASPTLLAIPLVVFAMLAPWDMYPAPGKQWLGNRMLAIQAWTFKTLTQQIVMPANVMGHKWALLLMSLLVFL 80 
25057547    1 MTLSLFDQFMSPTLLGVPLLPIALLLPWALFPNPACRWLLARLLTLQNWFIKQYAKHLFTPLDMGGHKWALLFTSLMVFI 80 
25057564    1 MTLSLFDQFMSPTFLGVPLLPIALLLPWALFPNPACRWLLARLLTLQNWFIKQYAKHLFTPLDMGGHKWALLFTSLMVFI 80 
209664433   1 MTVTLFDQFLSPTLFKLPLIVIALTTPWLLHHVTTTRFSSERLLSIKKISVSALTKHIFQPLGPLGHKWALLFVSLFMFL 80 
226453402   1 MTVTLFDQFLSPTLFKVPLIAIALIIPWLLHHVVTTRFSSERLLSVKKVSVSTLTKHIFQPLGPLGHKWALLFVSLFMFL 80 
226453454   1 MTVTLFDQFLSPTLFKMPLIAIALVTPWLLHHVVTTRFSSERLLSVKKVSVSALTKHIFQPLGPLGHKWALMFVSLFMFL 80 
226453363   1 MTVTLFDQFLSPTLFKMPLIAIALVSPWLLHHVVTTRFSSERLLSVKKVSVSALTKHIFQPLGPLGHKWALMFVSLFMFL 80 
51235010   81 ITINMLGLLPYTFTPTTQLSLNMGFAVPLWLATVIIGMRNQPTVALGHLLPEGTPIPLIPVLIIIETISLFIRPLALGVR 160
25057533   81 ITLNMLGTLPYTFTPTTQLSLSLGLALPLWLATVLIGLRYHPVRSFSHLLPESTPTLLIPVLIIIETISLLVRPLALGVR 160
25057458   81 ITLNTLGTLPYTFTPTTQLSMSLGLALPLWLATVIIGLRYNPTHSFAHLLPQSTPVALIPALIMIETASLLVRPLALGVR 160
25057476   81 ITLNMMGTLPYTFTPTTQLSLSLGLAFPLWLATVIIGLRYHPVRSIGHLLPESTPTLLIPVLIIIETISLLVRPLALGVR 160
25057547   81 MTLNLLGLLPYTFTPTTQLALTLGLAMPLWLMTIIIGLRNKPNAVIVHFLPKGTPRPLIPVLIIIETTSVIIRPLALAVR 160
25057564   81 MTLNLLGLLPYTFTPTTQLALTLGLAMPLWLMTIIIGLRNKPNAVIIHFLPKGTPRPLIPVLIIIETTSVIIRPLALAVR 160
209664433  81 ITLNVLGLLPYTFTPTTQLSLTFSLALPLWLATVLIGFRLDPTRALAHMLPQGTPPLLIPILIIIETISVLIRPLALAVR 160
226453402  81 ITLNVLGLLPYTFTPTTQLSLTFSLALPLWLATVLIGFRLDTTRALAHMLPQGTPPLLIPVLIIIETISVMIRPLALAVR 160
226453454  81 ITLNVLGLLPYTFTPTTQLSLTFSLALPLWLATVLIGFRLDPTRALAHMLPQGTPPLLIPVLIIIETISVMIRPLALAVR 160
226453363  81 ITLNVLGLLPYTFTPTTQLSLTFSLALPLWLATVLIGFRLDPTRALAHMLPQGTPPLLIPVLIIIETISVMIRPLALAVR 160
51235010  161 LTANLTAGHLLIQLIATAVFVLLPMMPTVAILTATVLFLLTLLEVAVAMIQAYVFVLLLSLYLQENV 227
25057533  161 LAANLTAGHMILQMIASTTLGMLCVLSPTGLLGAVILYLLACLELVVAAIQAYVFVLLLSLYLQENV 227
25057458  161 LAANLTAGHMILQMIASTGITMLYALSPAGIFGVIILYLLTGLEIMVAAIQAYVLVLLLSLYLQENV 227
25057476  161 LAANLTAGHLILQMIASTTIGLLCLMNPAGLLGAVVLYLLACLELAVAAIQAYVFVLLLSLYLQENV 227
25057547  161 LMANLTAGHLMMQLIAMATLALIPYLMPIWILTWTLLSLLLVLEVAVALIQAYVFVLLLSLYLQENI 227
25057564  161 LMANLTAGHLMMQLIAMATLTLIPYLMPLWILTWTLLSLLLVLEVAVALIQAYVFVLLLSLYLQENI 227
209664433 161 LMANLTAGHLLIHLISTGVFLLTSMMPMTAVLALMLLGLLTLLEIAVAVIQAYVFVLLLSLYLLENV 227
226453402 161 LMANLTAGHLLIHLISTGVFLLTSMMPMTAILALMLLGLLTLLEIAVAVIQAYVFVLLLSLYLLENV 227
226453454 161 LMANLTAGHLLIHLISTGVFLLTSMMPMTAILALALLGLLTLLEIAVAVIQAYVFVLLLSLYLLENV 227
226453363 161 LMANLTAGHLLIHLISTGVFLLTSMMPMTAILALALLGLLTLLEIAVAVIQAYVFVLLLSLYLLENV 227
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap