Conserved Protein Domain Family
CYTB

?
MTH00131: CYTB 
cytochrome b; Provisional
Statistics
?
PSSM-Id: 177189
View PSSM: MTH00131
Aligned: 504 rows
Threshold Bit Score: 717.202
Threshold Setting Gi: 108793251
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
46238037    1 MASLRKTHPLLKIANDALVDLPTPSNISAWWNFGSLLGLCLIIQILTGLFLAMHYTSDIATAFSSVAHICRDVNYGWLIR 80 
5835330     1 MAIIRKTHPLAKIINSAFIDLPAPSNISSWWNMGSLLGLCLIAQIITGLFLAMHYVSDINSAFSSVAHICRDVNYGWLIR 80 
17981761    1 MTTIRKNHPLFKAANSALIDLPAPASLSSLWNFGSLLGLCLISQIATGLFLAMHYAPETSSAFASVAHICRDVNYGWLIR 80 
25057433    1 MAITRKTHPLAKIINSAFIDLPAPSNISSWWNMGSLLGMCLMSQIITGLFLAMHYVSDISSAFSSVAHICRDVNYGWLIR 80 
38639895    1 MAIMRKTHPLAKIINSAFIDLPAPSNISSWWNMGSLLGLCLIVQIITGLFLAMHYISDINLAFSSVAHICRDVNYGWLIR 80 
166240028   1 MAILRKTHPLLKIANSALVDLPAPSNISAWWNFGSLLGLCLASQIVTGLFLAMHYTSDISTAFSSVAHICRDVNFGWLIR 80 
166240005   1 MAILRKTHPLLKIANSALVDLPAPSNISAWWNFGSLLGLCLASQIVTGLFLAMHYTSDISTAFSSVAHICRDVNFGWLIR 80 
242624410   1 MTSLRKTHPLLKIANHALVDLPAPSNISAWWNFGSLLGLCLIAQIVTGLFLAMHYTSDIATAFSSVAHICRDVNFGWLIR 80 
242624424   1 MASLRKTHPLLKIANDALIDLPTPSNISVWWNFGSLLGLCLASQIATGLFLAMHYTSDIATAFSSVTHICRDVNYGWLIR 80 
242624437   1 MTSLRKTHPLLKIANHALVDLPAPSNISAWWNFGSLLGLCLIAQIVTGLFLAMHYTSDIATAFSSVAHICRDVNFGWLIR 80 
46238037   81 NLHANGASFFFICIYMHIARGLYYGSYLYKETWNVGVVLLLLVMATAFVGYVLPWGQMSFWGATVITNLFSAVPYVGDAL 160
5835330    81 NFHANGASLFFICIYLHIARGLYYGSYLYTETWNMGVILLLLTMMTAFVGYVLPWGQMSFWGATVITNLLSAIPYIGDTL 160
17981761   81 NMHANGASFFFVCIYIHIGRGLYYGSYLYKETWNIGVVLLLLVMMTAFVGYVLPWGQMSFWGATVITNLLSAVPYIGESL 160
25057433   81 NFHANGASLFFICIYLHIARGLYYGSYLYMETWNIGVILLLLTMMTAFVGYVLPWGQMSFWGATVITNLLSAIPYIGDTL 160
38639895   81 NIHANSASLFFICIYLHIARGLYYGSYLYMETWNVGVILLLLTMMTAFVGYVLPWGQMSFWGATVITNLLSAVPYIGDTL 160
166240028  81 NLHANGASFFFVCIYLHIGRGLYYGSYLYKETWNIGVVLLLLVMMTAFVGYVLPWGQMSFWGATVITNLLSAVPYVGDTL 160
166240005  81 NLHANGASFFFVCIYLHIGRGLYYGSYLYKETWNIGVVLLLLVMMTAFVGYVLPWGQMSFWGATVITNLLSAVPYVGDTL 160
242624410  81 NMHANGASFFFICIYMHIGRGLYYGSYLYKETWTIGVILLLLVMMTAFVGYVLPWGQMSFWGATVITNLLSAVPYVGGTL 160
242624424  81 NLHANGASFFFMCIYAHIGRGLYYGSYLYKETWNIGVILLLLVMMTAFVGYVLPWGQMSFWGATVITNLLSAVPYVGNML 160
242624437  81 NMHANGASFFFICIYMHIGRGLYYGSYLYKETWTIGVVLLLLVMMTAFVGYVLPWGQMSFWGATVITNLLSAVPYVGGTL 160
46238037  161 VQWIWGGFSVDNATLTRFFAFHFLLPFIVTAVTLIHLLFLHETGSNNPLGLSSNTDKISFHPYFSYKDLLGFTIMLIALT 240
5835330   161 VQWIWGGFSVDKPTLTRFFAFHFILPFAIAAASLVHIVFLHETGSNNPVGINSDADQIPFHPYFTFKDLLGFIILLLIII 240
17981761  161 VQWLWGGFAVDNATLTRFFAFHFLLPFVILALTLIHLIFLHETGSNNPLGLPSNSDKIPFHPYYTIKDIFGFLVLLFALI 240
25057433  161 VQWIWGGFSVDKPTLTRFFAFHFILPFAIAAASLVHIVFLHETGSNNPMGINSNADKIPFHPYYTFKDLLGFIILLLIII 240
38639895  161 VQWIWGGFSVDKPTLTRFFAFHFILPFAIAGASLVHILFLHETGSNNPLGINSNADKIPFHPYYTYKDLLGFIILLLIIL 240
166240028 161 VQWIWGGFSVDKATLTRFFAFHFLLPFVVAAATMLHLLFLHETGSNNPIGINSNADKIPFHPYYTYKDLLGFAILITALA 240
166240005 161 VQWIWGGFSVDKATLTRFFAFHFLLPFVVAAATMLHLLFLHETGSNNPIGINSNADKIPFHPYYTYKDLLGFAILITALA 240
242624410 161 VQWIWGGFSVDNATLTRFFAFHFLLPFVVLAATLLHLLFLHETGSNNPAGLNSDADKIPFHPYFSYKDLLGFALMLLALA 240
242624424 161 VQWIWGGFSVDNATLTRFFAFHFLLPFVILAATLVHLLFLHETGSNNPLGLNSNVDKISFHPYFSYKDLLGFMVLLTALT 240
242624437 161 VQWIWGGFSVDNATLTRFFAFHFLLPFVVLAATLLHLLFLHETGSNNPAGLNSDADKIPFHPYFSYKDLLGFALMLLALA 240
46238037  241 SLALFSPNLLGDPDNFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLALLASILVLMVVPLLHTSKQRGLTFRPL 320
5835330   241 MLALLSPNLLNDPGNFTPANPLITPPHIKPEWYFLFAYAILRSIPNKLGGVLALLFSILILMLVPLLHTSKIRSATFRPL 320
17981761  241 SLALFAPNLLGDPDNFTPANSMVTPAHIKPEWYFLFAYAILRSIPNKLGGVIALLCSILVLLVVPILHTSKHRSLTFRPI 320
25057433  241 SLALLSPNLLNDPENFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLALLFSIIILMLVPFLHTSKIRSATFRPL 320
38639895  241 MLALLSPNLLNDPENFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLALLFSIIVLMFVPFLHTAKIRTSTFRPL 320
166240028 241 ALSLFSPNLLGDPENFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLALLFSILVLLLVPFLHTSKLRSMTFRPI 320
166240005 241 ALSLFSPNLLGDPENFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLALLFSILVLLLVPFLHTSKLRSMTFRPI 320
242624410 241 SLALFSPNYLGDPDNFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLALLASILVLLLVPFLHTSKQRSLTFRPL 320
242624424 241 SLSLFSPNLLGDPDNFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLALLASILVLMLVPFLHTSKQRSLTFRPF 320
242624437 241 SLALFSPNYLGDPDNFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLALLASILVLLLVPFLHTSKQRSLTFRPL 320
46238037  321 TQFLFWTLIANIIILTWIGGMPVEHPFVIIGQIASVLYFSLFLVFIPLTGWLENKALEWS 380
5835330   321 FKITLWILAADVLILTWIGGQPVEDPYIIIGQAASILYFLIFLVLMPLSGWLENKMLNRD 380
17981761  321 TQFLFWLLIADVLVLTWIGGMPVEAPYIITGQIASALYFSLFLILMPMASWLENKMLTW- 379
25057433  321 FKITLWILAADVLILTWIGGQPVEDPYITIGQVASILYFLIFLVFMPMSGWIENKMLNRN 380
38639895  321 FKITLWILAADVMILTWIGGQPVEDPYIMIGQVASVLYFTIFLVFMPVSGWIENKMMNRN 380
166240028 321 SQFLLWTLVADVAVLTWIGGMPVEHPYIIIGQVASALYFALFLILMPLAGVVENKMLKLS 380
166240005 321 SQFLLWTLVADVAVLTWIGGMPVEHPYIIIGQVASALYFALFLILMPLAGVVENKMLKLS 380
242624410 321 SQFLFWTLVADVLILTWIGGMPVEHPYIIIGQIASFIYFSIFLGLFPIAGWLENKLLQMT 380
242624424 321 SQLLFWTLIANVLILTWIGGMPVEDPYIIIGQIASFTYFFLFLVLMPLTGWVENKVMGWT 380
242624437 321 SQFLFWALVADVLILTWIGGMPVEHPYIIIGQIASFIYFSIFLGLFPMAGWLENKLLQMT 380
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap