Conserved Protein Domain Family
COX3

?
MTH00130: COX3 
cytochrome c oxidase subunit III; Provisional
Statistics
?
PSSM-Id: 177188
View PSSM: MTH00130
Aligned: 442 rows
Threshold Bit Score: 450.37
Threshold Setting Gi: 215979742
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66276093    1 MARQAHAYHMVDPSPWPLTGATAALLLTSGLAVWFHYHSTTLMTLGLILMLLTMYQWWRDIVREGTYMGHHTPPVQKGLR 80 
218157294   1 MAHQAHAYHMVDPSPWPLTGAVGALLLTSGLAVWFHFHSTILLSLGLILLLLTMYQWWRDIIREGTFQGHHTPPVQKGLR 80 
284178616   1 MAHQAHAYHMVDPSPWPLTGAAGALLLTSGLAVWFHFHTTILLSLGLILLLLTMYQWWRDIVREGTYQGHHTPPVQKGLR 80 
289183000   1 MTHQAHAYHMVDPSPWPLTGAVAALLVTSGLAIWFHFNSTALLTLGLVLLLLTMYQWWRDIVREGTYQGHHTPPVQKGLR 80 
289183070   1 MAHQAHAYHMVNPSPWPLTGAVAALLLTSGLAIWFHFNSLVLLVLGLILLLLTMYQWWRDITREGTFQGHHTPPVQKGLR 80 
289183084   1 MAHQAHAYHMVDPSPWPLTGAVAALLLTSGLAIWFHFNSSILLTLGLVLLLLTMYQWWRDITREGTFQGHHTPPVQKGLR 80 
289183098   1 MAHQAHAYHMVDPSPWPLTGAVAALLLTSGLAIWFHFNSSILLTLGLVLLLLTMYQWWRDITREGTFQGHHTPPVQKGLR 80 
289183308   1 MTHQAHAYHMVDPSPWPLTGAIAALLLTSGLAIWFHFNSTTLLALGLILLLLTMYQWWRDIVREGTFQGHHTPPVQKGLR 80 
299823669   1 MAHQAHAYHMVDPSPWPLTGAAGALLLTSGLAVWFHFHTTILLSLGLILLLLTMYQWWRDIVREGTYQGHHTPPVQKGLR 80 
301353441   1 MAHQAHAYHMVDPSPWPLTGAIGALLLTSGLAVWFHFHSTILLSLGLILLLLTMYQWWRDIIREGTFQGHHTPPVQKGLR 80 
66276093   81 YGMIPFITSEVFFFLGFFWAFFHSSLAPTPELGGCWPPTGITPLDPFEVPLLNTAVLLASGVTVTWAHHSLMEGQRKEAI 160
218157294  81 FGMILFITSEVFFFLGFFWAFYHSSLAPTPELGGCWPPTGITTLDPFEVPLLNTAVLLASGVTVTWAHHSIMEGEREQAI 160
284178616  81 FGMILFITSEVFFFLGFFWAFYHSSLAPTPELGGCWPPTGITPLDPFEVPLLNTAVLLASGVTVTWAHHSIMEGEREQAI 160
289183000  81 YGMILFITSEVFFFLGFFWAFYHSSLAPTPELGGCWPPTGITPLDPFEVPLLNTAVLLASGVTVTWAHHSIMAGEHKQAV 160
289183070  81 YGMILFITSEVFFFLGFFWAFYHSSLAPTPELGGCWPPTGITPLDPFEVPLLNTAVLLASGVTVTWAHHSIMEGHRKQAI 160
289183084  81 YGMILFITSEVFFFLGFFWAFYHSSLAPTPELGGCWPPTGLTPLDPFEVPLLNTAVLLASGVTVTWAHHSIMEGQRKQAI 160
289183098  81 YGMILFITSEVFFFLGFFWAFYHSSLAPTPELGGCWPPTGLTPLDPFEVPLLNTAVLLASGVTVTWAHHSIMEGQRKQAI 160
289183308  81 YGMILFITSEVFFFLGFFWAFYHSSLAPTPELGGCWPPTGITPLDPFGVPLLNTAVLLASGVTVTWAHHSIMAGERGQAI 160
299823669  81 FGMILFITSEVFFFLGFFWAFYHSSLAPTPELGGCWPPTGITPLDPFEVPLLNTAVLLASGVTVTWAHHSIMEGEREQAI 160
301353441  81 FGMILFITSEVFFFLGFFWAFYHSSLAPTPELGGCWPPTGITTLDPFEVPLLNTAVLLASGVTVTWAHHSIMEGERQQAI 160
66276093  161 QSLALTILLGCYFTTLQAMEYYEAPFTIADGVYGSTFFVATGFHGLHVIIGTSFLAgICLLRQIKYHFTSQHHFGFEAAA 240
218157294 161 HSLTLTILLGFYFTFLQAMEYYEAPFTIADGVYGSTFFVATGFHGLHVIIGSTFLA-VCLLRQVQYHFTSGHHFGFEAAA 239
284178616 161 QSLALTILLGFYFTFLQALEYYEAPFTIADGVYGSTFFVATGFHGLHVIIGSTFLA-VCLLRQLQYHFTSGHHFGFEAAA 239
289183000 161 HSLLLTILLGFYFTFLQAMEYYEAPFTIADGVYGSTFFVATGFHGLHVIIGSTFLA-VCFLRQVQHHFTSQHHFGFEAAA 239
289183070 161 QSLLLTILLGFYFTFLQAMEYYEAPFTIADGVYGSTFFVATGFHGLHVIVGSTFLA-VCLLRQVQHHFTSEHHFGFEAAA 239
289183084 161 QSLLLTILLGFYFTFLQAMEYYEAPFTIADGVYGSTFFVATGFHGLHVIIGSTFLA-VCLLRQIQHHFTSQHHFGFEAAA 239
289183098 161 QSLLLTILLGFYFTFLQAMEYYEAPFTIADGVYGSTFFVATGFHGLHVIIGSTFLA-VCLLRQIQHHFTSQHHFGFEAAA 239
289183308 161 HSLLLTILLGFYFTFLQAMEYYEAPFTIADGIYGSTFFVATGFHGLHVIIGSTFLA-VCLLRQLQHHFTSEHHFGFEAAA 239
299823669 161 QSLALTILLGFYFTFLQALEYYEAPFTIADGVYGSTFFVATGFHGLHVIIGSTFLA-VCLLRQLQYHFTSGHHFGFEAAA 239
301353441 161 QSLALTILLGFYFTFLQAMEYYEAPFTIADGVYGSTFFVATGFHGLHVIIGSTFLA-VCLLRQIQYHFTSEHHFGFEAAA 239
66276093  241 WYWHFVDVVWLFLYVSIYWWGS 262
218157294 240 WYWHFVDVVWLFLYISIYWWGS 261
284178616 240 WYWHFVDVVWLFLYISIYWWGS 261
289183000 240 WYWHFVDVVWLFLYISIYWWGS 261
289183070 240 WYWHFVDVVWLFLYVSIYWWGS 261
289183084 240 WYWHFVDVVWLFLYISIYWWGS 261
289183098 240 WYWHFVDVVWLFLYISIYWWGS 261
289183308 240 WYWHFVDVVWLFLYISIYWWGS 261
299823669 240 WYWHFVDVVWLFLYISIYWWGS 261
301353441 240 WYWHFVDVVWLFLYISIYWWGS 261
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap