Conserved Protein Domain Family
COX2

?
MTH00129: COX2 
cytochrome c oxidase subunit II; Provisional
Statistics
?
PSSM-Id: 177187
View PSSM: MTH00129
Aligned: 461 rows
Threshold Bit Score: 427.208
Threshold Setting Gi: 108793452
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
157736051   1 MAHPSQLGFQDAASPVMEELLHFHDHALMIVFLISTLVLYIIVAMVSTKLTNKYILDSQEIEIIWTILPAIILILIALPS 80 
108793396   1 MARPSQLGFQDAASPVMEELLNFHDYAMVIVFLISTLVLYIIVVTASTKLTDKKLTQSQGAEMIWTVAPAILLIMVALPS 80 
5835321     1 MAHPTQLGLQDASSPIMEELLLFHDHALMTVFLISTLVLYIIMTAVSTKLTNKHLLDAQEIEIVWTVMPALVLIAIALPS 80 
25057424    1 MAHPAQLGLQDASSPIMEELLHFHDHALMIVFLISTLVLYIITTTVSTKLTNKHLLDAQEIEMVWTVMPALVLITIALPS 80 
38639886    1 MAHPAQLGLQDASSPIMEELMHFHDHALMIVFLISTLVLYIITTTVSTKLTNKHLLDAQEIEMVWTVMPALVLITIALPS 80 
237869116   1 MAHPAQMGLQDAASPVMEELIHFHDHTLMVIFLISNFVLYIIVAVVSTKLTNKYAHDAQEIEIVWTVLPAVILILIALPS 80 
237869131   1 MAHPAQVGLQDAASPVMEELIHFHDHTLMVIFLISNFVLYIIVAVVSTKLTNKHAHDAQEIEIVWTVLPAVILILIALPS 80 
237880822   1 MAHPAQVGLQDAASPVMEELIHFHDHALMVIFLISNFVLYIIVAVVSTKLTNKHAHDAQEIEIVWTVLPAVILILIALPS 80 
237869145   1 MAHPSQLGLQDAASPVMEELLHFHDHALMVIYLISTFVLYIILTVVTTKLTNKFAHDSQEIEIIWTVLPAVILIMIALPS 80 
237880836   1 MAHPSQLGLQDAASPVMEELLHFHDHALMVIFLISTFVLYIILTVVTTKLTNKYAYDSQEIEIIWTVLPAVILILIALPS 80 
157736051  81 LRILYLMDEINDPHLTIKAMGHQWYWSYEYTDYEDLGFDSYMIPTQDLTPGQFRLLEADHRMVIPVESPIRVLVSAEDVL 160
108793396  81 LRILYIMDEINNPHLTVKAVGHQWFWSYEYSDHENIEFESYMIPTNDLSEGQYRLLEADNRMVVPTKAQVRMLITSDDVI 160
5835321    81 LRILYLMDEINDPHLTIKATGHQWYWSYEYTDYDTLNFDSYMIPTQDLLPGQFRLLDTDNRMVVPTGSPVRMLITAEDVL 160
25057424   81 LRILYLMDEINDPHLTIKATGHQWYWSYEYTDYETLNFDSYMVPTQDLLPGQFRLLDTDNRMVVPTNSPVRMLITAEDVL 160
38639886   81 LRILYLMDEINDPHLTIKATGHQWYWSYEYTDYGTLNFDSYMTPTQDLMPGQFRLLDTDNRMVVPMESPVRMLITAEDVL 160
237869116  81 LRILYLMDEINNPHLTVKAIGHQWYWSYEYTDYKDLAFDSYMIPTQDLTPGQFRLLEVDRRMVIPAESPIRMLITAEDVL 160
237869131  81 LRILYLMDEINNPHLTVKAIGHQWYWSYEYTDYKDLAFDSYMIPTQDLTPGQFRLLEVDHRMVIPAESPIRMLITAEDVL 160
237880822  81 LRILYLMDEINNPHLTVKAIGHQWYWSYEYTDYKDLAFDSYMIPTQDLTPGQFRLLEVDHRMVIPAESPIRMLITAEDVL 160
237869145  81 LRILYLMDEINNPHLTIKAIGHQWYWSYEYTDYKDLSFDSYMIPTQDLTPGQFRLLEVDHRMVIPIDSPIRMLITAEDVL 160
237880836  81 LRILYLMDEINNPHLTIKAIGHQWYWSYEYTDYKDLAFDSYMVPTQDLTPGQFRLLEVDHRMVIPTESPIRVLITAEDVL 160
157736051 161 HSWAVPALGVKMDAVPGRLNQTAFIASRPGVFYGQCSEICGANHSFMPIVVEAVPLEHFENWSSLMLEDA 230
108793396 161 HAWAVPALGLKVDAVPGRLNQTAFIIGRPGVFYGQCSEICGANHSFMPIVVETIDTEDFVFWISTMLES- 229
5835321   161 HSWAVPSLGLKMDAVPGRLNQTTFIATRPGVFFGQCSEICGANHSFMPITIESAPVKYFESWSSSMLAES 230
25057424  161 HSWAVPSLGLKMDAVPGRLNQATFIATRPGIFFGQCSEICGANHSFMPIAIESAPVKYFESWSSSMLAES 230
38639886  161 HSWAVPSLGLKMDAVPGRLNQATFIATRPGIFFGQCSEICGANHSFMPIAIESTPIKHFESWSSSMLAES 230
237869116 161 HSWAVPSLGIKMDAVPGRLNQATFIASRPGVYYGQCSEICGANHSFMPITVEAVPLKHFEDWSTSTLEEA 230
237869131 161 HSWAVPSLGIKMDAVPGRLNQATFIASRPGIYYGQCSEICGANHSFMPIAVEAVPLKHFEDWSTSMLEEA 230
237880822 161 HSWAVPSLGIKMDAVPGRLNQATFIASRPGIYYGQCSEICGANHSFMPIAVEAVPLKYFEDWSTSMLEEA 230
237869145 161 HSWTVPSMGVKMDAVPGRLNQATFIASRPGVYYGQCSEICGANHSFMPIVIEAIPLKHFEDWSTSMLET- 229
237880836 161 HSWAVPSLGIKMDAVPGRLNQATFITSRPGVYYGQCSEICGANHSFMPIAIEAVPLKHFEDWSTSMLEA- 229
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap