Conserved Protein Domain Family
ND4L

?
MTH00126: ND4L 
NADH dehydrogenase subunit 4L; Provisional
Statistics
?
PSSM-Id: 177185
View PSSM: MTH00126
Aligned: 444 rows
Threshold Bit Score: 126.233
Threshold Setting Gi: 5835326
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
51235013   1 MTPVHFSFSSAFILGLMGLAFHRTHLLSALLCLEGMMLSLFIALALWALQFESTGFSTAPMLLLAFSACEASTGLALLVA 80 
165932474  1 MTPTQFAFSSAFIMGTTGLTFHRTHLLSALLCLEGMMLSLLIALALWSLELDSAGPMASPMILLAFSACEAGAGLALLIA 80 
165932488  1 MTPTQFAFSSAFIMGTAGLTFHRTHLLSALLCLEGMMLSLLIALAFWSLELDSAGPMASPMILLAFSACEASAGLALLVA 80 
197311137  1 MTLTHYAFSSSFFMGLLGLIFYRTHLLSALLCLEAMMLTLFISLSIWALQLVSTSFMACPLILLALSACEAGAGLALLVA 80 
208969326  1 MMPIHFAFTTAFALGLTGLAFQRTHLLSALLCLEGMMLSLYIALSLWTLQLDSSGFSPAPMILLAFSACEASAGLALLVA 80 
215260091  1 MMPIHFAFTTAFALGLTGLAFQRTHLLSALLCLEGMMLSLYIALSLWTLQLDSSGFSPAPMVLLAFSACEASAGLALLVA 80 
221143479  1 MMPIHFAFTTAFALGLTGLAFQRTHLLSALLCLEGMMLSLYIALSLWTLQLDSSGFSPAPMILLAFSACEASAGLALLVA 80 
254055012  1 MTPIHYACSSSYFMGLVGLVLYRTQLLSALLCLEAMMLILFISLSLWALQLMSTMFAACPMILLALSACEASAGLALLVA 80 
254055040  1 MTPIHYAFSSSFLMGLLGLVFYRTHLLSALLCLEAMMLTLFISLSLWALQLMSTMFVACPMILLAFSACEASAGLALLVA 80 
53793989   1 MMPIHFAFTTAFALGLTGLAFQRTHLLSALLCLEGMMLSLYVALSLWSLQLDSSGFSPAPMILLAFSACEASAGLALLVA 80 
51235013  81 TARTHGTDRLQNLNLLQC 98 
165932474 81 TSRTHGGDQMKNLNLLQC 98 
165932488 81 TSRTHGGDRLKNLNLLQC 98 
197311137 81 TARSHGTDRLKNLSLLRC 98 
208969326 81 TSRTHGSDRLKNLNLLQC 98 
215260091 81 TSRTHGSDRLKNLNLLQC 98 
221143479 81 TSRTHGSDRLKNLNLLQC 98 
254055012 81 TARSHGSGRLKNLSLLRC 98 
254055040 81 TARTHGTDRLKNLSLLKC 98 
53793989  81 TSRTHGSDRLKNLNLLQC 98 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap