Conserved Protein Domain Family
ATP6

?
MTH00120: ATP6 
ATP synthase F0 subunit 6; Provisional
Statistics
?
PSSM-Id: 177181
View PSSM: MTH00120
Aligned: 194 rows
Threshold Bit Score: 229.326
Threshold Setting Gi: 62184514
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
83309049    1 MTMNLFDQFLSPKVLGIPLSTIALIFPLLLFklCHSQRLISNRISTLQTWLLMKFTKHLMSPINKSGHPWTLLLTTLMCF 80 
74310606    1 MNMNMFDQFASPEILLMPVSLVAMLVPIMFI--RPNNSILGNRMSTMLNWFFKTVLLNMIHQLSPIGQKWSRFLVSLLVF 78 
74310592    1 MNLNMFEQFASPEILLLPTNIMSMLIPILLI--YTKPTLLGNRISTILNWFLKTALSNMINQLSLAGQKWSRFLMSLLLL 78 
74310578    1 MNMNMFEQFASPEILYVPTSLLSMLMPILFI--RPNNMLLGNRTSAIMSWFFKTILTNMMNQLSPTGQKWSRFLTGLLVF 78 
74310564    1 MNMNMFNQFICPEILTLPITPVLLIITLLIT--NNKPKLLSNRMTTAMKFMLKNLSINMANQLSKQGQKWLHLLMSLLIT 78 
74310511    1 MNMNMFEQFASPEVLFIPVTMGSMLMPIIMI--HSNHSLLGNRMTMIIKWFLKTMLYNMVHQLSPKGQKWSRFLAGAIMF 78 
164420885   1 MHLNLFDQFKCPEILFIPTFTLALLISPLFL--RNKTNLLENRSTALLSWALKLTSKNFMSQLSTAGQKWTNLLTGLFLL 78 
212725556   1 MNLNMFEQFANPEILFIPTTPLSLLLPLLFI--SHKPKLLSNRMLTATNLFIKTASSNMLSQLPPAGQKWSRPLIALLTL 78 
227018586   1 MNPNMFEQFASPDILLVPTSLISMVLPVMLI--HNKPTLLGNRLSAIMDQLLKMIMLNMLHQLSPIGQKASRFLTALILL 78 
301353292   1 MNLTMFDQFASPTIFLFPTALLSLLMPLLLI--HNKQTLLGNRASTILNWFCKMAMLNMIHPLSKLGQKWSRFLISLLLM 78 
83309049   81 LLLLNTLGLLPYTFTPTAQLSTNMALAVPMWLSTVLTGLRNQPANSLAHMLPLGTPTPLIPILIIIETVSLLIRPVALGV 160
74310606   79 ILLSNLLGLLPYTFTTTSQLSMNMAMAIPMWMATVVTGMTTKTSSTLAHMLPEGSPTPLIPFMIMIETISLFMRPIALGV 158
74310592   79 ILLSNLLGLLPYTFTTTSQLSMNMAFAIPMWLGTVITGLTMKTSSSLAHMLPEGSPTPLIPFMILIETISLLMRPIALGV 158
74310578   79 ILLSNLLGLLPYTFTPTSQLSMNMALAIPMWLATIITGLTTKTSSTLAHMLPEGSPTPLIPFMILIETISLFMRPIALGV 158
74310564   79 IMLSNLIGLLPYTFTTTSQLYINMTLALPMWMATVITGLLNKPSHTLAHMLPETSPTPLIPFMIMIETVSLLMRPLALGV 158
74310511   79 IMLSNLLGLLPYTFTTTSQLSMNMAMAIPLWLATLITGMTLKPSSTLAHMLPEGSPTPLIPFMIMIETVSLLMRPIALGV 158
164420885  79 ILSSNLLGLLPYTFSTTSQLSTNMALAFPLWLGTVLVGAFSKPNISIAHLLPEGAPMTLAPMLILIESVSLLIRPIALGV 158
212725556  79 ILVSNLLGLLPYTFTTTSQLSINMAMAIPLWMATIITGLSLKPTTALAHMLPEGSPTPLIPFMILIESVSLLMRPVALGV 158
227018586  79 ILLSNLLGLLPYTFTTTSQLSMNMALAVPLWLATVVTGIMLKPTTAAAHMLPEGSPTPLTPMMIMIETVSLFMRPLALGV 158
301353292  79 IILSNLLGLLPYTFTTTSQLSTNMSLAIPMWLATVMTGLTMKPSSTLAHMLPEGSPTPLIPAMIMIETVSLFMRPIALGV 158
83309049  161 RLTANLTAGHLLITLISTTIMTLMKTSLTLSLFTMTLLLSLSLLEIAVAVIQAYVFTLLLSLYLQENT 228
74310606  159 RLTANITAGHLLMTMISSATLNFFNVYNTLCITMTTLLFLLTLLEMAVACIQAYVFVLLVTLYLQENT 226
74310592  159 RLTPNITAGHLLMTMISSAALSFINMYNTLSIMTMMLLMLLTLLEMAVACIQAYVFILLITLYLQENT 226
74310578  159 RLTANITAGHLLMTMISSAVLNFFNSYNTLSALMLILLFLLTLLEMAVACIQAYVFVLLITLYLQENT 226
74310564  159 RLTANITAGHLLMTMISSTALIFLNNMITLHMMTMILLMLLTILEMAVACIQAYVFTLLVILYLQENT 226
74310511  159 RLTANITAGHLLMTMISSAALSFINTINTMSIMMTALLILLTLLEVAVACIQAYVFVLLVTLYLQENT 226
164420885 159 RLTANITAGHLLIHMISSSTMELINSLTPLSSITLALLITLTFLEIAVACIQAYVFTLLLSLYLEENT 226
212725556 159 RLTANITAGHLLMTMISSATLSLLHT--PLCLFTTTLLTLLSLLEVAVACIQAYVFVLLVTLYLQENT 224
227018586 159 RLTANITAGHLLMTMVSSAIMNLLNTYNSVCTLMLILMLLLTLLEMAVACIQAYVFMLLVTLYLQENT 226
301353292 159 RLTANITAGHLLMTMISSAVLNLINIYNTLSLLLTILLTLLTLLEIAVACIQAYVFVLLVTLYLQENT 226
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap