Conserved Protein Domain Family
COX3

?
MTH00118: COX3 
cytochrome c oxidase subunit III; Provisional
Statistics
?
PSSM-Id: 177179
View PSSM: MTH00118
Aligned: 184 rows
Threshold Bit Score: 424.364
Threshold Setting Gi: 296940272
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
74310593    1 MTHqQLHQYHMVDPSPWPLTGAMGSLLLASGLALWFHTNTTTVLKLGMLTMILTTIQWWRDVIREGTYQGHHTKGVQKNL 80 
62184515    1 MKH-QTHPFHMVDPSPWPILAATAALFTTWGLGTWMHTKTMTTLEIGLITMLLTSYQWWRDVTREATFQGHHTKKVQKGL 79 
145976934   1 MKH-QTHPFHMVNPSPWPILAAMAALLTTWGLGMWMHTKIPTTLEIGLLTISLTSDQWWRDITREATFQGHHTKKVQKGL 79 
226463965   1 MNN-QMHPFHMVNESPWPILGSMALFTTACGLATWMHHKTFTLLNLGLTSTLLTSYQWWRDIVREGTFQGHHTTKVQTGL 79 
226464147   1 MTN-QMHPYHMVNESPWPILGSTALFTTACGLTTWMHLKTMTLLNLGLITTLLTAYQWWRDIIRESTYQGHHTTKVQTGL 79 
226463952   1 MNN-QMHPFHMVNESPWPVLGSMALFTMACGLATWMHTKTMMLLNLGLTATLLTSYQWWRDIVRESTFQGHHTTKVQMGL 79 
281376636   1 MTN-QNHPYHMVNPSPWPILAALAAFTTALGLTMWMHTKSTESLSIGLLTMMLTSYQWWRDIVREGTYQGHHTKIVQNGL 79 
296940230   1 MNN-QMHPYHLVNESPWPILGSMAVFTIACGLATWMHTKNMTLMFLGLAATLLTSYQWWRDIVRESTYQGCHTTKVQTGL 79 
296940244   1 MNN-QMHPYHMVNESPWPILGSMALFTMACGLATWMHHKTMVLLNIGLISTVLTSFQWWRDIVRESTFQGHHTTKVQTGL 79 
121622412   1 MNN-QMHPFHMVNESPWPILGSMALFTTACGLATWMHYKTLTLMSLGSTATLLTVYQWWRDIIRESTFQGHHTTKVQIGL 79 
74310593   81 RYGMMLFIVSEVLFFLGFFWTLYHVSLFPTPELGAEWPPTGITPLNPLEVPLLNTAVLLSSGATITWSHHTMMKGNKTES 160
62184515   80 RYGMILFITSEVLFFFGFFWTFFFLSLNPSHPLGLQWPPKGIKPLDPFEIPLLNTMVLLTSGFTVTWAHHSIMEGSRKGA 159
145976934  80 RYGMILFITSEVLFFFGFFWTFFFLSLNPSHPLGLQWPPKGIKSLDPFEIPLLNTMVLLTSGFTVTWAHHSIMEGSRKNT 159
226463965  80 RYGMILFITSEVLFFFGFFWTFYFTSTNPDHALGLQWPPKGIKPLSPIDVPLLNTMILLASGVTITWSHHSIMTGLKKNT 159
226464147  80 RYGMILFITSEVLFFFGFFWTFYFSSTNPNPTLGLQWPPKGIEPLNPIEVPLLNTMILLASGMTLTWSHHSIMKGLKKNT 159
226463952  80 RYGMILFITSEVLFFFGFFWTFYFASTNPDHALGLQWPPKGITPLNPIDVPLLNTMILLASGMTVTWSHHSIMAGLKKNT 159
281376636  80 RYGMILFISSELLFFFGLFWTFFFLSFNPSPDIGMQWPPKGITPLDPFQVPLLNTMVLLASGFTVTWAHHSLMEGKRKKT 159
296940230  80 RYGMILFISSEVLFFFGFFWTFYFTSTNPDLALGLQWPPKGIEPLNPMEVPLLNTMILLASGMTVTWAHHSLMTGFKKNT 159
296940244  80 RYGMILFITSEVLFFFGFFWTFYFVSTNPDHALGLQWPPKGIEPLNPIEVPLLNTMILLASGMTVTWSHHSIMAGLKKNA 159
121622412  80 RYGMILFITSEVLFFFGFFWTFYFACTNPDHALGLQWPPKGIEPLNPMEVPLLNTMILLASGMTVTWSHHSIMLGLKKNS 159
74310593  161 TYALMITIALGIYFTALQLSEYMETPFTISDSVYGSIFFVATGFHGLHVMIGTTFLIVCLTRLIQYHFTTTHHFGYEAAI 240
62184515  160 IQALTMTILLGLYFTVLQATEYLEAPFTISDGAYGSIFFVATGFHGLHVIIGTTFLITCLLRQLQHHFTTSHHFGFEAAA 239
145976934 160 IQALTATVLLGLYFTALQAMEYLEAPFTISDGAYGSIFFVATGFHGLHVIIGTTFLITCLLRQLQYHFTTSHHFGFEAAA 239
226463965 160 SWSLLMTTTLGLYFTLLQASEYYNTAFSISDGTYGATFFVATGFHGLHVMIGTTFLIICLMRQIHRHFTTKHYFGFEAAA 239
226464147 160 SWSLLLTTLLGGYFTLLQALEYKDTKFSISDGTYGAIFFMATGFHGLHVMIGTSFLIICLMRQMHSHFTTKHYFGFEAAA 239
226463952 160 SWSLLMTVTLGLYFTLLQASEYYNTMFSISDGTYGATFFVATGFHGLHVMIGTTFLIICLMRQVRRHFTTKHYFGFEAAA 239
281376636 160 IAALSATILLGAAFTALQASEYYEAPFTMSDGAYGSIFFLATGFHGFHVIIGTTFLTVCLMRQLFYHFTTAHHFGFEAAA 239
296940230 160 SLALTMTVMLGLYFTLLQATEYYNTMFSISDGAYGATFFVATGFHGLHVIIGTCFLITCLMRQLYLHFTTKHFFGFEAAA 239
296940244 160 SLSLLMTVTLGLYFTLLQATEYYNTMFSISDGAYGATFFVATGFHGLHVIIGTSFLIICLVRQMLSHFTTKHFFGFEAAA 239
121622412 160 SWSLLMTVTLGIYFTLLQATEYFNTPFSISDGAYGATFFVATGFHGLHVIIGTTFLIVCLARQIYSHFTTKHYFGFEAAA 239
74310593  241 WYWHFVDVVWLFLFVSVYWWGS 262
62184515  240 WYWHFVDVVWIFLYTSIYWWGS 261
145976934 240 WYWHFVDVVWIFLYTSIYWWGS 261
226463965 240 WYWHFVDVVWIFLYTSIYWWGS 261
226464147 240 WYWHFVDVVWLFLYTSIYWWGS 261
226463952 240 WYWHFVDVVWIFLYASIYWWGS 261
281376636 240 WYWHFVDMVWIFLFTSIYWWGS 261
296940230 240 WYWHFVDVVWIFLYASIYWWGS 261
296940244 240 WYWHFVDVVWIFLYTSIYWWGS 261
121622412 240 WYWHFVDVVWIFLYTSIYWWGS 261
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap