Conserved Protein Domain Family
COX2

?
MTH00117: COX2 
cytochrome c oxidase subunit II; Provisional
Statistics
?
PSSM-Id: 177178
View PSSM: MTH00117
Aligned: 245 rows
Threshold Bit Score: 384.266
Threshold Setting Gi: 108640050
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
74310509    1 MPYATQLSLQEATGPTMEEVIFLHDHVLMLTFLMTLVIMTFSMTAVTAKLTHNDpTEEVEQLEAAWTAAPIMILILTALP 80 
226463819   1 MVEPIQLSLHDAASPMMEELLFFHDYSMLMMLLIGTTVIIALLIASTTKTYHTA-LTDANHLEFLWTLLPVMILLFLATP 79 
226463936   1 MVEPIQLSLHDAASPVMEELLFFHDYSMLMMLLIGTTVIIALIIASTMKTYHTA-LTDANHLEFLWTLLPVMILLFLATP 79 
226453504   1 MVEPIQLSLHDAASPVMEELLFFHDYSMLMMLLIGTTVIIALMIASTTKTYHTA-LTDANHLEFLWTLLPVMILLFLATP 79 
226463949   1 MVEPIQLSLHDAASPVMEELLFFHDYSMLMMLLIGTTVIIALVIASTMKTYHTA-LTDANHLEFLWTLLPVMILLFLATP 79 
226463962   1 MVEPIQLSLHDAASPVMEELLFFHDYSMLMMLMIGTSVIIALVIASTTKTYHTA-LTDANHLEFLWTLLPVMILLFLATP 79 
226463975   1 MVEPIQLSLHDAASPVMEELLFFHDYSMLMMLLIGTTVIIALMIASTTKTYHTA-LTDANHLEFLWTLLPVMILLFLATP 79 
226464014   1 MVEPIQLSLHDAASPVMEELLFFHDYSMLMMLLIGTTVIIALLIASTTKTYHTA-LTDANHLEFLWTLLPVMILLFLATP 79 
296940227   1 MVEPIQLALHDAASPMMEELLFFHDYSMLMMILIGTTVIIALIIATTMKTYHTA-LTDANHLEFLWTLLPVMILLFLATP 79 
121622409   1 MVEPIQLTLHDAASPMMEELLFFHDYSMLMMLLIGTTVIIALVIASTMKTYHTA-LTDANHLEFLWTLLPVMILLFLAMP 79 
74310509   81 SVRSLYLMEEVFDPYVTIKATGHQWYWNYEYTDGINISFDSYMIQTQDLPNGSPRLLEVDNRMIMPANLQARVVVTAEDV 160
226463819  80 SMRTLFLLENQESPNTTIKAIGHQWYWSYEYSDYENISFDSYMIQDQDLEKGSPRLLETDNRMVFPMQTPIRLLISAEDV 159
226463936  80 SMRTLFLLENQENPHTTIKAVGHQWYWSYEYSDYENILFDSYMIQDQDLENGSPRLLETDNRMVFPMQTPTRLLISAEDV 159
226453504  80 SMRTLFLLENQESPNTTIKAIGHQWYWSYEYSDYENILFDSYMIQDQDLEKGSPRLLETDNRMVFPMQTPVRLLISAEDV 159
226463949  80 SMRTLFLLENQENPHTTIKAIGHQWYWSYEYSDYENILFDSYMIQDQDLEKGSPRLLETDNRMVFPMQVPTRLLISAEDV 159
226463962  80 SMRTLFLLENQENPNTTIKAIGHQWYWSYEYSDYENILFDSYMIQNQDLEKGSPRLLETDNRMVFPMQTPVRLLISAEDV 159
226463975  80 SMRTLFLLENQESPNTTIKAIGHQWYWSYEYSDYENILFDSYMIQDQDLEKGSPRLLETDNRMVFPMQTPVRLLISAEDV 159
226464014  80 SMRTLFLLENQETPNTTIKAIGHQWYWSYEYSDYENVLFDSYMIQDQDLEKGSPRLLETDNRMVFPMQTPIRLLISAEDV 159
296940227  80 SMRTLFLLEDQENPQVSIKALGHQWYWSYEYSDYENILFDSYMIQDPDLEKGSPRLLETDNRMIFPMQTPTRLLISAEDV 159
121622409  80 SMRTLFILEHQESPNTTIKALGHQWYWSYEYSDYENVMFDSYMMQDQNLDNGSPRLLETDNRMVFPTLTPTRLLVSSEDV 159
74310509  161 LHSWTVPSLGVKVDAVPGRLNQLPLATSRTGVFFGQCSEICGANHSFMPIVVEAVPLKHFEHWLTCEK 228
226463819 160 LHSWTLPALGVKIDAVPGRLNQLIISTMRPGIFYGQCSEICGANHSFMPISTESVPTKYFEKWLDKMM 227
226463936 160 LHSWTLPALGVKIDAVPGRLNQLIISTMRPGIFYGQCSEICGANHSFMPISTESVPTKYFEKWLDKMI 227
226453504 160 LHSWTLPALGVKIDAVPGRLNQLIISTMRPGIFYGQCSEICGANHSFMPISTESVPTKYFEKWLDKMA 227
226463949 160 LHSWTLPALGVKIDAVPGRLNQLIISTMRPGIFYGQCSEICGANHSFMPISTESVPTKYFEKWLDKML 227
226463962 160 LHSWTLPALGVKIDAIPGRLNQLIFSTMRPGIFYGQCSEICGANHSFMPISTESVPTKYFEKWLDKMA 227
226463975 160 LHSWTLPALGVKIDAVPGRLNQLIISTMRPGIFYGQCSEICGANHSFMPISTESVPTKYFEKWLDKMA 227
226464014 160 LHSWTLPALGVKIDAVPGRLNQLIISTLRPGIFYGQCSEICGANHSFMPISTESVPTKYFEKWLDKMA 227
296940227 160 LHSWTLPTLGVKIDAVPGRLNQLILSTMRPGIFYGQCSEICGANHSFMPIATEAVPTKHFEKWLDKML 227
121622409 160 LHSWTLPALGVKIDAIPGRLNQLILTTMRPGIFYGQCSEICGANHSFMPIATESVPTKYFEKWLENM- 226
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap