Conserved Protein Domain Family
COX1

?
MTH00116: COX1 
cytochrome c oxidase subunit I; Provisional
Statistics
?
PSSM-Id: 177177
View PSSM: MTH00116
Aligned: 243 rows
Threshold Bit Score: 886.744
Threshold Setting Gi: 296940240
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
209886984   1 MFITRWLFSTNHKDIGTLYLLFGAWSGLIGACLSILMRMELTQPGSLLGSDQIFNVLVTAHAFIMIFFMVMPIMIGGFGN 80 
145976930   2 STMNRWFLSTNHKDIGTLYFVFGIMAGISGSVTSLMVRMQLIQPGQSSGGDSLYNMFITYHALTMIFFMVMPIMIGGFGN 81 
153124543   2 SFLTRWLLSTNHKDIGTLYFLFGAAAGLTGSLVSLLVRAQLMQPGQALGGDSLYNVFITFHALVMIFFMVMPIMIGGFGN 81 
62184511    2 STMNRWLLSTNHKDIGTLYFLFGVGPGMPGSVTSLLIRMKLIQPGESSGGDSLYNMFITYHALTMIFFMVMPIMIGGFGN 81 
107736791   2 SKVTRWLFSTNHKDIGTLYFLFGTFAGLVGSAVSLMVRTQLAQPGQ-HTNDTLYNTFITLHAFIMIFFMVMPIMIGGFGN 80 
226464143   1 MWLLRWLLSTNHKDIGTMYFLFGLAAGLIGATSSLLMRTKLSQPGFSLGDYHSYNVLITLHGLTMIFFMVMPIMIGGFGN 80 
280978072   2 SKMSRWLFSTNHKDIGTLYFLFGTAAGLIGSAVSLMVRMQLVQPGQ-YTNDTMYNTFITLHAFIMIFFMVMPIMIGGFGN 80 
296940226   1 MWLLRWLLSTNHKDIGTMYFMFGLMAGLIGATSSLLMRTKLCQPGFSLGDDHAYNVLITLHGLTMIFFMVMPIMIGGFGN 80 
296940240   1 MWLLRWLLSTNHKDIGTMYFMFGLAAGLVGATSSLLMRTKLSQPGFTLGDDHAYNVLITLHGLTMIFFMVMPIMIGGFGN 80 
296940268   2 STMSRWLFSTNHKDIGTLYFLFGAAAGLTGSVVSLFVRMQLIQPGQSTGGDSLYNMFITYHALTMIFFMVMPIMIGGFGN 81 
209886984  81 WLIPLMIGAPDMAFPRMNNMSFWLLPPALLLLLSSSYVEAGAGTGWTVYPPLSGNLVHSGPSVDLAIFSLHLAGASSILG 160
145976930  82 WLVPLMLGAPDMAFPRLNNMSFWLLPPAFLLLVSSAWFNSGVGTGWTIYPPLSGNLAHAGPSMDLAIFALHLAGASSILG 161
153124543  82 WLVPLMLGAPDMAFPRMNNMSFWLLPPSFLLLLFSSGFETGVGTGWTIYPPLSNNIAHSGPSMDLAIFSLHLAGASSILG 161
62184511   82 WLVPLMLGAPDMAFPRLNNMSFWLLPPSFLLLMSTAWFNSGVGTGWTIYPPLSGNLAHAGPSMDLAIFALHLAGASSILG 161
107736791  81 WLVPMMLGAPDMAFPRMNNMSFWLLPPAFFLLLTASKLGEGVGTGWTIYPPLSGNMAHSGPSTDMAIFALHLAGASSILG 160
226464143  81 WLVPLMLGAPDMAFPRMNNMSFWLLPPSFLLLLASSKVGAGVGTGWTIYPPLSGNMAHSGPSMDLAIFSLHLAGISSILA 160
280978072  81 WLVPMMLGAPDMAFPRMNNMSFWLLPPAFFLLLTASKLGDGVGTGWTIYPPLSGNLAHSGPSTDMTIFALHLAGASSILG 160
296940226  81 WLIPLMLGTPDMAFPRMNNMSFWLLPPSFLLLLASSKTGDGVGTGWTIYPPLSGNTAHSGPSMDLAIFSLHLAGVSSILA 160
296940240  81 WLVPLMLGAPDMAFPRMNNMSFWLLPPSFLLLLASSKTGTGVGTGWTIYPPLSGNMAHAGPSMDLAIFSLHLAGISSILA 160
296940268  82 WLIPLMLGSPDMAFPRMNNMSFWLLPPSFSLLLLSSWCGSGVGTGWTIYPPLSGNLAHSGPSMDLAIFALHLAGASSILG 161
209886984 161 AINFITTCINMKPKSMPMFNIPLFVWSVLITAIMLLLALPVLAAAVTMLLTDRNLNTSFFDPSGGGDPVLFQHLFWFFGH 240
145976930 162 AINFITTCINMSPHHMSPHNWPLFVWSVFLTAVLLLLSLPVLAAAITMLLTDRNLNTTFFDPNGGGDPILFQHLFWFFGH 241
153124543 162 AINFITTCINMSPSRTSPYNWPLFVWSVFFTATLLLLSLPVLAAAITMLITDRNLNTSFFEPSGGGDPILFQHLFWFFGH 241
62184511  162 AINFITTCINMSPHHMSPYNWPLFVWSVFLTAILLLLSLPVLAAAITMLLTDRNLNTTFFDPNGGGDPILFQHLFWFFGH 241
107736791 161 AINFITTCINMSPHSMTPLNWPLFVWSVFLTAILLLLAIPVLAAAITMLLTDRNLNTAFFDPAGGGDPILFQHLFWFFGH 240
226464143 161 SINFISTCINMKPHHMVLYNLPLFVWSVLLTAILLILSLPVLAAAITMLLTDRNLNTAFFDPLGGGDPILFQHLFWFFGH 240
280978072 161 AINFITTCINMAPHSMTPLNWPLFVWSVFLTAVLLLLAIPVLAAAITMLLTDRNLNTTFFDPAGGGDPILFQHLFWFFGH 240
296940226 161 SINFITTSINMKPHHMVMYNLPLFVWSVLLTAVLLILALPVLAAAITMLLTDRNLNTAFFDPVGGGDPILFQHLFWFFGH 240
296940240 161 SINFITTSINMKPHYMVLYNMPLFVWSVLLTAILLILALPVLAAAITMLLTDRNLNTAFFDPVGGGDPILFQHLFWFFGH 240
296940268 162 AINFITTCINMGPHFMTPYNWPLFVWSVFLTAVLLLLSLPVLAAAITMLLTDRNLNTSFFDPGGGGDPILFQHLFWFFGH 241
209886984 241 PEVYILILPGFGIVSSIITFYTGKKNTFGYTSMIWAMMSIAILGFVVWAHHMFTVGLDIDSRAYFTAATMIIAIPTGIKV 320
145976930 242 PEVYILILPGFGIISHIVMHHSSKKEPFGYVSMVWAMLAITVLGFIVWAHHMFTVGLDIDTRAYFSAATMTIAVPTGIKV 321
153124543 242 PEVYILILPGFGIISHIVTHYSGKKEPFGYHSMVWAMLAITVLGFVVWAHHMFTVGLDIDTRAYFSAATMTIAIPTGIKV 321
62184511  242 PEVYILILPGFGMISHIVTHHSSKKEPFGYMSMVWAMLAITVLGFIVWAHHMFTVGLDVDTRAYFSAATMTIAVPTGIKV 321
107736791 241 PEVYILILPGFGIISHIITHYTGKKEPFGYHSMVWAMLAITTLGFVVWAHHMFTVGLDIDTRAYFSAATMTIAVPTGIKV 320
226464143 241 PEVYILILPGFGIISHIITHYSCKKEPFGYMSMVWAMLTITLLGFMVWAHHMFTVGLDIDTRAYFSAATMTIAVPTGIKV 320
280978072 241 PEVYILILPGFGIISHIVTHYSGKKEPFGYHSMVWAMLAITTLGFIVWAHHMFTVGLDIDTRAYFSAATMTIAIPTGIKV 320
296940226 241 PEVYILILPGFGIISHIITHYSCKKEPFGYMSMVWAMLTITILGFMVWAHHMFTVGLDIDTRAYFSAATMTIAVPTGIKV 320
296940240 241 PEVYILILPGFGIISHIITHYSCKKEPFGYMSMVWAMLAITILGFMVWAHHMFTVGLDIDTRAYFSAATMTIAVPTGIKV 320
296940268 242 PEVYILILPGFGIISHIVTHYASKKEPFGYLSMVWAMLAITVLGFIVWAHHMFTVGLDIDTRAYFSAATMTIAVPTGIKV 321
209886984 321 FGWLATLTGGQIKWQTPIYWALGFIFLFTVGGMTGIILANSSLDIVLHDTYYVVAhfHFHYVLSMGAVFAIMAGFVHWFP 400
145976930 322 FSWAATIFGGKIHWTVPMFWAAGFIYLFTLGGLTGIMLSNSSIDTMLHDTYYVVA--HFHYVLSMGAVFAILAGLTYWFP 399
153124543 322 FSWTATIFGGKTHWAAPMMWAVGFIYLFTLGGLTGIMLSNSSLDTLLHDTYYVVA--HFHYVLSMGAVFAIMAGIIYWFP 399
62184511  322 FSWAATIFGGKIRWTVPMFWAAGFIYLFTLGGLTGIMLSNSSLDTMLHDTYYVVA--HFHYVLSMGAVFAIMEGLVHFHA 399
107736791 321 FSWSATMFGGKTKWDVPMLWATGFICLFTIGGLTGIMLSNSSLDTLLHDTYYVVA--HFHYVLSMGAVFAIMAGIVYWLP 398
226464143 321 FSWTATIFGGKINLEPPMLWSLGFMYLFTIGGLTGITLSNSTLDVLLHDTYYVVA--HFHYVLSMGAVFAIMAGTVYWFP 398
280978072 321 FSWSATIFGGKTKWNVPMLWATGFIYLFTIGGLTGIMLSNSSLDTLLHDTYYVVA--HFHYVLSMGAVFAIMAGVVYWFP 398
296940226 321 FSWTATIFGGKINWEPPMLWALGFMYLFTIGGLTGITLSNSTLDVLLHDTYYVVA--HFHYVLSMGAVFAIMAGTVYWFP 398
296940240 321 FSWTATIFGGKINWEPPMLWALGFMYLFTIGGLTGITLSNSTLDVLLHDTYYVVA--HFHYVLSMGAVFAIMAGTVYWFP 398
296940268 322 FSWTATIFGGKTYWSVPMLWALGFIYLFTLGGLTGIMLSNSSLDILLHDTYYVVA--HFHYVLSMGAVFAIMAGVMYWFP 399
209886984 401 LFTGFTLHKIWTKAQFAVMFVGVNLTFFPQHFLGLAGMPRRYSDFPDAFTLWNTVSSIGSTISMVAVLMSMFIVWEAMTQ 480
145976930 400 MLTGYSLNQTMAKAQFWTMFTGVNITFFPQHMLGLAGMPRRYSDFPDAYAIWSTMSTTGSIISFTSAISMIAILWEAFSK 479
153124543 400 MLTGFALNQTMTKMQFWTMFLGVNITFFPQHMLGLAGMPRRYSDYPDAYTTWNTISSVGSVISMMGALMLIVIIWEAFTM 479
62184511  400 MLTGYSLNSTLAKAQFWAMFTGVNITFFPQHMLGLAGMPRRYSDFPDAYAIWNTISSMGSIMSLVSALTMIVILWEAFSK 479
107736791 399 VLTGATLNQQLAKTQFWIMFTGVNITFFPQHMLGLAGMPRRYSDFPDTYTIWNNMSSLGSVISMMGAIMFIGLIWEALSK 478
226464143 399 LISGFALNKKLAYSQFTTMFIGVNITFFPQHMLGLAGMPRRYSDFPDAYAVWNTISSSGALISMLGALMMVLVMWEAMAK 478
280978072 399 VLTGATLNQPMAKVQFWMMFTGVNITFFPQHMLGLAGMPRRYSDFPDTYTLWNSMSSLGSTISMAAAMMLIGLLWEALSK 478
296940226 399 LISGFALNNKLAYSQFIIMFVGVNITFFPQHMLGLAGMPRRYSDFPDAYSIWNNISSTGALISMLGALMMVLILWEAMTK 478
296940240 399 LISGFALNKKLAYSQFTIMFIGVNITFFPQHMLGLAGMPRRYSDFPDAYAIWNNISSTGALISMLGALMMVLILWEAMTK 478
296940268 400 TLTGYALNQTMAKAQFWIMFIGVNLTFFPQHMLGLAGMPRRYSDFPDAYAVWNTLSSIGSTISMTGALMLIAILWEAMSK 479
209886984 481 KRELQMPLGKKTHPEWFYGAPPPLHTHTEPTYMLNNS 517
145976930 480 KRLTTPITTDTKSQEWTQGTPPPQHTFNTPPMIQQT- 515
153124543 480 KRKLPSTWPSMKMQEWVYELPPKHHTFNETPLIH--- 513
62184511  480 KRSTTPATTDAKLQEWTQGTPPPQHTFNTPPMVQTT- 515
107736791 479 KQKTPSTQNDKKPQEWTQGCPPPNHTFTTTPMVTTQE 515
226464143 479 KRKTLQALSDTTMLEWTQKCPPTRHTFENPPTALPQG 515
280978072 479 KQKTLPTQSDKKPQEWTQGCPPPNHTFTTPPLVMTQP 515
296940226 479 KRKISRTLSNTTMLEWTQNCPPLRHTFENPPTMLLQG 515
296940240 479 KRKISRTLSDTTMLEWTQKCPPLRHTFENPPATLLQG 515
296940268 480 KRLTTPTSLDLKLQEWTQGCPPPQHTFNTTTLTLPQE 516
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap