Conserved Protein Domain Family
ND3

?
MTH00113: ND3 
NADH dehydrogenase subunit 3; Provisional
Statistics
?
PSSM-Id: 177175
View PSSM: MTH00113
Aligned: 186 rows
Threshold Bit Score: 101.496
Threshold Setting Gi: 148543139
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
51038591    2 NTTTSLIILALIISITLIMLNNQLTMTKPNNDKLSPYECGFDPLKTMRLPFSIRFFLSSNSIsAIWLSKIALLLPLPWAI 81 
50659188    2 NLMISISMIYLALPTILTLLNYWFTLTKPDNEKLSPYECGFDPLKTTRPPFSIRFFLVAILF-LLFDLEIALLLPLPWAI 80 
138892605   2 NLMILISIIYLALPTILTLLNYWFTLTKPDNEKLSPYECGFDPLKTTRPPFSIRFFLVAILF-LLFDLEIALLLPLPWAI 80 
148543139   2 NLMISITMIYLALPTILTLLNYWFTLAKPDNEKLSPMWMRLRPIKNHSPTIFNSIFLSSNFI------------PSIWFS 69 
190349490   2 NLMISITMIYLALPAILTMLNYWFTLTKPDNEKLSPYVCGFDPLKTTRPPFSIRFFLVAILF-LLFDLEIALLLPLPWAI 80 
190349378   2 NLMISITMIYLALPTILTMLNYWFTLTKPDNEKLSPYECGFDPLKTTRPPFSIRFILVAILF-LLFDLEIALLLPLPWAI 80 
219524182   2 NLMISITVIYLTLPMTLTMLNYWFTLTKPDNEKLSPYECGFDPLKTTRPPFSIRFFLVAILF-LLFDLEIALLLPLPWAI 80 
222839270   2 NLMISITMIYLALPMILTLLNYWFTLTKPDNEKLSPYECGFDPLKTTRPPFSIRFFLVAILF-LLFDLEIALLLPLPWAI 80 
295442706   2 NLMISITMIYLALPMILTLLNYWFTLTKPDNEKLSPYECGFDPLKTTRPPFSIRFFLVAILF-LLFDLEIALLLPLPWAI 80 
302632658   2 NLMISITMIYLALPTILTLLNYWFTLAKPDNEKLSPYECGSTHKSPPSPTIFNSIFLSSNFI------------PSIWFS 69 
51038591   82 QLMAPTYTLTWTITILLL-LTFGFIYEWIQ--GGLEWA 116
50659188   81 QLPHPTYTFTWAFIIMSL-LTLGLLYEWIQ--GGLEWA 115
138892605  81 QLPYPTYTFTWAFIIMSL-LTLGLLYEWIQ--GGLEWA 115
148543139  70 NRTTTTSAMSHSTPMSNLhLYLSLHYHIITnpGPPLWM 107
190349490  81 QLPHPIYTFIWAFIIMSL-LTLGLVYEWIQ--GGLEWA 115
190349378  81 QHPYPAYTFTWAFIIMSL-LTLGLLYEWIQ--GGLEWA 115
219524182  81 QLQYPTYTFTWAFIIMSL-LTLGLLYEWIQ--GGLEWA 115
222839270  81 QLPYPIYTFTWAFIIMSL-LTLGLLYEWIQ--GGLEWA 115
295442706  81 QLPYPTYTFTWAFIIMSL-LTLGLLYEWIQ--GGLEWA 115
302632658  70 NRTTTTSAMSHSTPMSNLhLYLSLHYHIITnpGPPLWM 107
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap