Conserved Protein Domain Family
ND4

?
MTH00110: ND4 
NADH dehydrogenase subunit 4; Provisional
Statistics
?
PSSM-Id: 177172
View PSSM: MTH00110
Aligned: 268 rows
Threshold Bit Score: 674.3
Threshold Setting Gi: 14010689
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
14530824    1 MLKILIPTFMLLPLTWFSPNKMIWINNSIYSMLICMISLKFLYQYSQPNLNLSLTFFTDALSTPLLILSTWLLPLMLIAS 80 
21717313    1 MLKIIIPTIMLFPVTWCSSSPMIWINTTLHSLLISLAGLLFLNQFNDSNNNFSLTFFSDSLSSPLVVLTMWLLPLMIMAS 80 
166851900   1 MLKIIIPTIMLFPVTWYSNNNMVWINTTSHSLLISLTGLLFLNQFNDNSNNFSLTFFSDPLSSPLMILTMWLLPLMIMAS 80 
14602235    1 MLKIILPTFMLIPLTWHSKKNNIWINTTAHSLMISLITLSLLNHWYNTNMNFSLTFFTDSLSTPLLILTTWLLPLMVMAS 80 
194277539   1 MLKIIVPTIMLFPVTWYSNNSKIWINTTSYSLLISFMGLSFLNQPNNNSNNFSMNFFSDPLSSPLLILTMWLLPLMIMAS 80 
238866872   1 MLKIIIPTIMLFPLTWHSNHRTLWINTTTHSLTISLISFHLLHQPNNN-LHFSTTFSSDTLSTPLVMLTTWLLPLMIMAS 79 
238866900   1 MLKIIIPTIMLFPVTWYSNKTMIWINTTSHSLLISLAGLSFLNQFSDNSNNFSLTFFSDPLSSPLVILTMWLLPLMIMAS 80 
238866928   1 MLKIIIPTIMLFPVTWYSNKTMIWINTTSHSLLISLAGLSFLNQFSDNSNNFSLTFFSDPLSSPLVILTMWLLPLMIMAS 80 
238866956   1 MLKIIIPTIMLFPVTWYSNNNMIWINTTSHSLLISLASLSFLNQSNDNSNNFSLTFFSDPLSSPLVILTMWLLPLMILAS 80 
238866970   1 MLKIIMPMIMMLPMTWYSNKPMIWINTTLHSLTISLVGLSFLNQLNDNSNNFSSTFFSDPLSSPLMMLTMWLLPLMILAS 80 
14530824   81 QNHMKLESKYNKKLYISLMILLQIILIMTFSATEMIMFFIMFEATLIPTLMIITRWGNQPERLNAGTYFLFYTLTGSLPL 160
21717313   81 QHHLKKEPWTLKKLYISMLIFLQMFLIMTFTATELILFYILFEATLIPTLIIITRWGNQTERLNAGLYFLFYTLIGSLPL 160
166851900  81 QYHLTKESWILKKLYLSMLISLQMFLVMTFTATELIWFYILFEATLIPTLIIITRWGNQTERLNAGLYFLFYTLIGSLPL 160
14602235   81 QNHLSKESLGRKKLYISMLVMLQIFLIMTFTATELVLFYILFEATLIPTLIIITRWGNQTERLNAGLYFLFYTLIGSLPL 160
194277539  81 QYHLKKEPWLRKKSYLSMLISLQMFLVMTFTANELILFYILFEATLIPTLIIITRWGNQTERLNAGLYFLFYTLIGSLPL 160
238866872  80 QHHLHKESLTRKKTYISMLISLQLTLIMMFSASELILFYILFETTLIPTLIIITRWGNQTERLNAGLYFLFYTLLGSLPL 159
238866900  81 QYHLTKESWILKKLYLSMLISLQMFLIMTFTATELILFYILFEATLIPTLIIITRWGNQTERLNAGLYFLFYTLIGSLPL 160
238866928  81 QYHLTKESWILKKLYLSMLISLQMFLIMTFTATELILFYILFEATLIPTLIIITRWGNQTERLNAGLYFLFYTLIGSLPL 160
238866956  81 QYHLTKESWTLKKLYLSMLISLQMFLIMTFTATELILFYILFEATLIPTLIIITRWGNQTERLNAGLYFLFYTLIGSLPL 160
238866970  81 QHHLAKESWTLKKSYLSMLIFLQMLLVMTFTATELILFYILFEATLIPTLIIITRWGNQTERLNAGLYFLFYTLTGSMPL 160
14530824  161 LVALTYLQNYLGSLNFMLMLYWPNSLNmSSWTNPLLWLACMLAFLIKMPLYGVHLWLPKAHVEAPIAGSMILAAILLKLG 240
21717313  161 LVALIHIQNYLGSLNMLTMSFCFQELS-NSWSSNLLWMACIMAFMVKMPLYGLHLWLPKAHVEAPIAGSMVLPPVLLKLG 239
166851900 161 LVALIYIQNYLGSLNMLTMKYYLQEMP-NSWSNNMLWMACIMAFMVKMPLYGLHLWLPKAHVEAPIAGSMVLAAVLLKLG 239
14602235  161 LIALIYTQNFMGTLNMASNSLIALNIP-NSWSNNILWLACMMAFMVKMPLYGLHLWLPKAHVEAPIAGSMVLAAILLKLG 239
194277539 161 LVALIHLQNSMGSLNLLTMNFWLKELP-NSWSSNLLWMACIMAFMVKMPLYGFHLWLPKAHVEAPIAGSMVLAAVLLKLG 239
238866872 160 LVVLIHMQNSLGSLNFNILSLYTQNTTtCSWSDDLMWMACMMAFLVKMPLYGTHLWLPKAHVEAPIAGSMVLAAVLLKMG 239
238866900 161 LVALIYIQNYMGSLNMLTMKFYLQEMP-NSWSNSILWMACIMAFMVKMPLYGLHLWLPKAHVEAPIAGSMVLAAVLLKLG 239
238866928 161 LVALIYIQNYMGSLNMLTMKFYLQEMP-NSWSNSILWMACIMAFMVKMPLYGLHLWLPKAHVEAPIAGSMVLAAVLLKLG 239
238866956 161 LVALIYIQNYLGSLNMLTMKLYFQEMP-NSWSNNILWMACIMAFMVKMPLYGLHLWLPKAHVEAPIAGSMVLAAVLLKLG 239
238866970 161 LVALIYVQNYSGSLNLLMMNLCFQELP-NSWSNNLLWMACIMAFMIKMPLYGLHLWLPKAHVEAPIAGSMVLAAVLLKLG 239
14530824  241 GYGMMRIVIMIQPSTEMLLYPFILLSLWGMVMTSSICLRQTDLKSLIAYSSVSHMALVITAIMIQTPWSFMGATALMLAH 320
21717313  240 GYGMMRITMILNPMTKYMAYPFLMLCLWGMIMTSSICLRQTDLKSLIAYSSVSHMALVIVAILIQTPWSFMGATILMIAH 319
166851900 240 GYGMMRITTILDPLTKHMAYPFLMLCLWGMIMTSSICLRQTDLKSLIAYSSVSHMALVVVGILIQTPWSFMGATILMVAH 319
14602235  240 GYGMMRMTIILNPLTEYMAYPFLMLSLWGMIMTSSICLRQTDLKSLIAYSSVSHMALVIVAILIQTPWSFIGATVLMIAH 319
194277539 240 GYGMMRITIILDPTTKAMAYPFLMLCLWGMIMTSSICLRQTDLKSLIAYSSVSHMALVIVAILIQTPWSFMGATALMIAH 319
238866872 240 GYGMMRMTSLLNPLTYDMAYPFLTLSLWGMIMTSSICLRQTDLKSLVAYSSVSHMALVITAILIQTPWSFMGATTLMIAH 319
238866900 240 GYGMMRITTILDPLTKHMAYPFLMLCLWGMIMTSSICLRQTDLKSLIAYSSVSHMALVVVGILIQTPWSFMGATILMVAH 319
238866928 240 GYGMMRITTILDPLTKHMAYPFLMLCLWGMIMTSSICLRQTDLKSLIAYSSVSHMALVVVGILIQTPWSFMGATILMVAH 319
238866956 240 GYGMMRITMILDPLTNHMAYPFLMLCLWGMIMTSSICLRQTDLKSLIAYSSVSHMALVVVGILIQTPWSFMGATILMVAH 319
238866970 240 GYGMMRITVILDSLTKFMAYPFFMLCLWGMIMTSSICLRQTDLKSLIAYSSVSHMALVIVAILIQTPWSFMGATILMIAH 319
14530824  321 GLTSSMLFCLANTNYERTHSRTMILARGLQSILPLMMLWWLMASLANLALPPTINLIGELMIITSMFSWSNMSIILLGLN 400
21717313  320 GLTSSMLFCLANSNYERIHSRTMLLARGIQTILPLMATWWLLASLTNLALPPSINLIGELFVTMASFSWSNITIILMGLN 399
166851900 320 GLTSSMLFCLANSNYERIHSRTMLLARGIQALLPLMATWWLLASLTNLALPPSINLIGELFVVMASFSWSNITIILMGLN 399
14602235  320 GLTSSLLFCLANTNYERIHSRTMTLARGLQTLLPLMATWWLLASLTNLALPPTINLVGELFIMMASFSWSHLTIILMGLN 399
194277539 320 GLTSSMLFCLANSNYERIHSRTMLLARGLQTLLPLMATWWLLASLTNLALPPSINLIGELFVMMASFSWSNISIILMGLN 399
238866872 320 GLTSSMLFCLANSNYERIHNRTMILARGLQTILPLMAIWWLLASLTNLALPPSINLIGELLILISTFSWSNLSILLTGLN 399
238866900 320 GLTSSMLFCLANSNYERIHSRTMLLARGIQALLPLMATWWLLASLTNLALPPSINLIGELFVTMASFSWSNITIILVGLN 399
238866928 320 GLTSSMLFCLANSNYERIHSRTMLLARGIQALLPLMATWWLLASLTNLALPPSINLIGELFVTMASFSWSNITIILVGLN 399
238866956 320 GLTSSMLFCLANSNYERIHSRTMLLARGIQALLPLMATWWLLASLTNLALPPSINLIGELFVTMASFSWSNITIILVGLN 399
238866970 320 GLTSSMLFCLANSNYERIHSRTMLLARGVQAFLPLMSTWWLLASLTNLALPPSINLIGELFVTMTSFSWSNITIILMGLN 399
14530824  401 MLLTSIYTLYMLITTQCGHMTTHTNSIYPSYTREHALMTLHILPLMLLSLNPKIILGTTF 460
21717313  400 MLITALYSLYMLTTTQRGKLTYHSHNLNPSFTRENTLMSMHMLPLLLFTLNPKIILGPTY 459
166851900 400 MLITALYSLYMLTITQRGKLTYHMHNLSPSLTRENTLMSMHMLPLLLLTLNPKIILGLTY 459
14602235  400 MLITALYSLYMLTMTQRGKYTYHINNIKPPFTRENTLMIMHLLPLILLSINPKLIMGNMC 459
194277539 400 MLITALYSLYMLITTQRGKPTFHTHNLNPSFTRENTLMSMHMLPLLFLTLNPKTILGPTL 459
238866872 400 TLITALYSLHMFISTQRGNLAHHISNIKPSFTRENTLMSMHIFPLLSLSLNPKIILGPTF 459
238866900 400 MLITALYSLYMLTITQRGKLTYHTYNLNPSLTRENTLMSMHMLPLLLLTLNPKIILGLTY 459
238866928 400 MLITALYSLYMLTITQRGKLTYHTYNLNPSLTRENTLMSMHMLPLLLLTLNPKIILGLTY 459
238866956 400 MVITALYSLYMLIITQRGKLTYHMHNLNPSLTRENTLMSMHMLPLLLLTLNPKIILGFMY 459
238866970 400 MLITALYSLYMLTMTQRGKPTYHMYNLNPSLTRENTLMTMHMFPLLLFILNPNTILGPTY 459
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap