Conserved Protein Domain Family
ND5

?
MTH00108: ND5 
NADH dehydrogenase subunit 5; Provisional
Statistics
?
PSSM-Id: 177170
View PSSM: MTH00108
Aligned: 281 rows
Threshold Bit Score: 973.56
Threshold Setting Gi: 18077893
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
166851901   1 MNLLTSFTLVTLMILTLPIIMNIMNAYKDyYPFTLHVKSSIACAFTTSLIPTALFISSGQEATIFNWHWMTIQTLKLFIS 80 
5835048     4 INISNTMSIMSIILLILPLLYNLLSLKKI--NFPLYCKNMIMLAFMMSLPSLLLFMYKGQESIITNWHWFSIHSFNISMS 81 
5836069     2 NLLFFSSLLTALIILCIPLLLSFTPYYKL-ENYPHHVKTMIMWSFIISLVPMLSFLNGGVEATVTNWHWFTTQTFNLSMN 80 
18077893    2 NLMFTSTLLMSLIILLIPLLTSYTPFYKL-TTYPHHVKNMTMWSFIISLFPLLLFLNQGFESTVTNWHWFTSQTLGLTMN 80 
45685716    2 NFILNSSSILTFTLLVFPILYNLVFPYKT-KQFPLHCKNTIMLAFLTSLLSFLTFILNGQESIITNWHWFSTHSFSISMS 80 
52547316    2 NFTLNSMILLSIIMLVSPLLYNMLMPHKT-TYFPTYCKNMIMMAFMTSLPPMIIFMLYGQESVITNWHWFSITTFNISMS 80 
56548744    1 MNISNTTSIMSIILLILPLLYNLLFPKKI--NFPLYCKNMIMLAFMTSLPSLLLFMYKGQESIITNWHWFSIHSFNISMS 78 
56548702    2 NLLLNSSAMLTIIILTLPLLHNAIFPNKT-HDFPLHCKNMITLAFTMSLTTLMTFILTGQETTITNWQWLSINTFTLNLS 80 
221145545   5 NHIFNSMLIMSIITLMSPLAYNMINPNKT-TNFPSLCKNAVKSAFFMSLIPLTLFIHMDQESMVTNWQWLSLGTLTINMS 83 
108793319   2 NNMLNTMTLMSITTLTTPLIINLIFPHKT-TKLPMYYKMAVKYAFLISLPPLLSFIHTGQESIITNWKWFSINSFNLTMS 80 
166851901  81 FKLDHFSMLFMPVALFVTWSIMEFSMWYMHSDPKIDQFFKYLLLFLITMLILVTANNLFQLFIGWEGVGIMSFLLIGWWY 160
5835048    82 FKMDFFSIIFIPIALFVTWAILEFSLWYMHSDPNISQFFKYLIIFLLTMIILVSANNLFQLFIGWEGVGIMSFLLIGWWY 161
5836069    81 FKLDLYTIMFLPIALLITWSIMEFSIWYMSSDPKINQFMKYLLIFLITMLTLISANNLFQLFIGWEGVGIMSFMLIGWWH 160
18077893   81 FKVDLYSIIFLPIALLVTWSIMEFSIWYMSSDPKINQFMKYLLIFLITMLTLISASNLFQLFVGWEGVGVMSFMLIGWWH 160
45685716   81 FKLDFFSIIFIPIALFVTWSILEFSLWYMHSDPNIFRFFKYLITFLLTMIILVSANNLFQLFIGWEGVGIMSFMLIGWWY 160
52547316   81 FKLDFFSIIFIPIALYDAWSILEFSLWYMHSDIFIHKFFKYLVSFLLTMIILVSANNLFQLFIGWEGVGIMSFLLIGWWY 160
56548744   79 FKMDFFSIIFIPIALFVTWAILEFSLWYMHSDPNISQFFKYLTIFLLTMIILVSANNLFQLFIGWEGVGIMSFLLIGWWY 158
56548702   81 FKFDYFSIIFIPIALYVTWSILEFSLWYMYSDPNIHRFFKYLTLFLLTMIILVSANNLFQLFIGWEGVGIMSFMLIGWWH 160
221145545  84 FKMDYFSVVFLPIALYITWSIMEFSMWYMHSDPDIHRFSKYLIMFLLTMTILVSANNLFQLFIGWEGVGIMSFMLIGWWY 163
108793319  81 FKLDYFSIIFIPIALYVTWSILEFSQWYMNSDPNIHQFFKYLVMFLLTMMILITANNLFQLFIGWEGVGIMSFMLIGWWH 160
166851901 161 GRTDANTAALQAILYNRMGDVGFILAMAWFLMYYITWEFQQMFMLNYDpsMIPLIGLLLAATGKSAQFGLHPWLPSAMEG 240
5835048   162 GRSDANTAALQAILYNRIGDIGFMLTMAWLMLNCNSWDLQHIFSMNMH--PIALLGLIIAATGKSAQFSLHPWLPSAMEG 239
5836069   161 ARTDANTAALQAILYNRIGDIGFILAMAWFLIHTNSWEFQQMFLLHTN--LLPLLGLILAATGKSAQFGLHPWLPFAMEG 238
18077893  161 ARTDANTAAMQAILYNRIGDIGFILAMAWFIMNSNSWELNQIFLLHMD--LLPLLGLILAATGKSAQFGLHPWLPSAMEG 238
45685716  161 GRTDANTAALQAILYNRIGDIGFMATMAWLMLNNNSWDLHHIFSINMS--TFALLGLILAAAGKSAQFGLHPWLPSAMEG 238
52547316  161 GRTDANTAALQAIIYNRIGDIGFMLTMAWLMLNSNSWELQNIFSTNMD--FIALLGLIIAATGKSAQFGLHPWLPSAMEG 238
56548744  159 GRSDANTAALQAILYNRIGDIGFMLTMAWLMLNCNSWDLQHIFSMNMH--PIALLGLIIAATGKSAQFSLHPWLPSAMEG 236
56548702  161 ARSDANTAALQAVLYNRIGDIGFMLSMAWLMINNNSWDLQQIFMTDMS--TLALLGLIIAATGKSAQFSLHPWLPSAMEG 238
221145545 164 GRTDANTAAMQAILYNRIGDIGFMLSMAWFMMNNNSWNLQHIFMTDID--SLALMGLIIAAAGKSAQFGLHPWLPSAMEG 241
108793319 161 GRSDANTAALQAILYNRIGDMGLMLTMVWLMINIGLWDLQHIFMTKMN--TLALLGLVIAATGKSAQFGLHPWLPSAMEG 238
166851901 241 PTPVSALLHSSTMVVAGIFLLIRFHPLMENNKPIQTLMLCLGAITTLFTAICALTQNDIKKIVAFSTSSQLGLMMVTMGI 320
5835048   240 PTPVSALLHSSTMVVAGIFLLIRFHPMLENNKTMLTITLCLGALTTLFTAMCAIMQNDIKKIVAFSTSSQLGLMMVTVGL 319
5836069   239 PTPVSALLHSSTMVVAGIFLLVRFSPLLEQNSTALTMALCLGAITTLFTAACALTQNDIKKIIAFSTSSQLGLMMVTIGL 318
18077893  239 PTPVSALLHSSTMVVAGIFLLIRFSPMFERNYVALTVALCLGAITTLFTAACALTQNDMQKIVTFSTSSQLGLMMVTVGL 318
45685716  239 PTPVSALLHSSTMVVAGIFLLIRFHPMLENNKTALDIILCLGAMTTLFTAICAITQNDIKKIVAFSTSSQLGLMMVTVGL 318
52547316  239 PTPVSALLHSSTMVVAGIFLLIRFHPMMENNQMILTTILCLGAMTTLFTAICAITQNDIKKIVAFSTSSQLGLMMVTVGL 318
56548744  237 PTPVSALLHSSTMVVAGIFLLIRFHPMLENNQMMLTITLCLGALTTLFTAMCAIMQNDIKKIVAFSTSSQLGLMMVTVGL 316
56548702  239 PTPVSALLHSSTMVVAGIFLLIRFHPMIQTNSTILSITLCLGAITTLFTAICAITQNDIKKIVAFSTSSQLGLMMVTIGL 318
221145545 242 PTPVSALLHSSTMVVAGVFLLIRFHPLLEKNQMALTMTLCLGAITTLFTAICAITQNDIKKIVAFSTSSQLGLMMVTMGL 321
108793319 239 PTPVSALLHSSTMVVAGVFLLIRFYPMMKDNNTILTIILCMGAITSLFAAICATTQNDIKKIVAFSTSSQLGLMMVTMGL 318
166851901 321 NQPYLAFLHICNHAFFKAMLFMCSGSIIHNLNDEQDIRKMGGLFKSMPFTSSSLTIGSLALTGMPFLTGFYSKDLIIESA 400
5835048   320 NQPHLAFLHICTHAFFKAMLFLCSGSIIHNLNDEQDIRKMGGLFYTLPITSSALMTGSLALMGTPFLAGFYSKDSIIEAM 399
5836069   319 NQPFLAFLHICTHAFFKAMLFLCSGSIIHNLNDEQDIRKMGGLINILPITSSALIIGSLALTGMPFLAGFYSKDLIIESL 398
18077893  319 NQPFLAFLHICTHAFFKAMLFLCSGSIIHNLNDEQDIRKMGGLVNTLPITSSALIIGSLALTGMPFLAGFYSKDSIIESL 398
45685716  319 NQPYLAFMHICTHAFFKAMLFLCSGSIIHSLNDEQDIRKMGGLFYSLPITSSALMTGSLALTGMPFLAGFYSKDSIIEAL 398
52547316  319 NQPHLAFLHICTHAFFKAMLFLCSGSIIHSLNDEQDIRKMGGLFLILPITSSALMTGSLALVGTPFLAGFYSKDSIIEAI 398
56548744  317 NQPHLAFLHICTHAFFKAMLFLCSGSIIHNLNDEQDIRKMGGLLYTLPITSSALMTGSLALMGTPFLAGFYSKDSIIEAM 396
56548702  319 NQPHLAFLHICTHAFFKAMLFLCSGSIIHSLNDEQDIRKMGGLLHSLPITSSCLMTGSLALMGTPFLAGFYSKDSIIEAM 398
221145545 322 NQPHLAFLHICTHAFFKALLFMCSGSIIHSLNNEQDIRKMGGLLKLLPITSSATILGSMALTGMPFLSGFYSKDSIIEAL 401
108793319 319 NQPHRTFLHMCTHAFFKATLFLCSGSIIHNLNNEQDIRKMGGLLNILPITSSALMTSSLALIGTPFLTGFYSKDPIIETM 398
166851901 401 NTSNINAWALTITLIATSMTAIYSTRIIFYALLGQPRFTTSTPINENNPLLINSIKRLTLGSIFAGFFLTNNILPMNIPQ 480
5835048   400 NTSYTNSWALTITLIATSLTAIYSLRIIYYTLLGHPRFMTMSPLNENNPNLINPIIRLALGTIFAGFMLTTNMPPSYSIT 479
5836069   399 NTSNTNAWALSLTLVATTFTAVYSTRVIFLALLNQPRFSPASSINENNPLLINPIKRLAIGSILAGFLLTSYINPTTLTP 478
18077893  399 NMSNANAWALCLTLVATTFTAVYSTRLVFLALLNQPRFSPMSMINENNPLLINPIKRLACGSVIAGFLLTTFINPTTLNP 478
45685716  399 NMSYTNSWALTITLIATSFTAVYSFRIIYYALMGYPRFPSISFINENNPNLINPIMRLATGSIFAGFILTSSIPPSSSIS 478
52547316  399 NTSYTNSWALMMTLIATSLTAIYSLRIIYYALLGNPRFSSISPINENNPNLINPIMRLAMGSIFAGFLVTMSIPPMTSIT 478
56548744  397 NTSYTNSWALTITLIATSLTAIYSLRIIYYALLGYPRFMTMSPLNENNPNLINPIIRLALGTIFAGFLLTTTIPPSSSII 476
56548702  399 NTSYTNSWALTTTLIATSLTAVYSLRIIYFALLNQPRSLPLSPLNENNPHLINSITRLALGSIFAGFILTMNISPSSMVP 478
221145545 402 NTSYINSWALSITLIATMTTAMYSMRMISLALLEEPRFTTMSPINENNPNLIKPIMRLTLGSIFAGFFITMNIPPTIVIP 481
108793319 399 NMSYINSWALTTTLITTTLTAMYSLRMIYFTLLNQPRFIPLLTINENHPNLKNPILRLTLGSIFTGYLLTMNIPTTYMNP 478
166851901 481 MTMPLYLKFTALAVTITGFALAMELNLMTKNLNLKLPSHLFKFSNSLGYYPTITHRLIPSHNLNQSQNTASLLLDLIWLE 560
5835048   480 MTMPMFIKQMALMVTTTGLMMGMELNSLTNKL-MKSNNHTNNFLTMLGFYTQIMHRMQPLISLFMGQRIATMLIDMNWYE 558
5836069   479 TTMPPFIKVTALVITILGFILALELYLTTNNLTLKPHSQLHTFSNLLGYFPLIMHRKPTAQNFFLGQNMATMLIDLTWFE 558
18077893  479 TTMPLYIKMAAITVTLLGFLLALELYMATNNLTHKPHSQIYSFSNLLGYFPLIIHRKPTTQNFSLSQSMATMLIDLTWFE 558
45685716  479 MTMPLMIKLSALIISLLGLYIGMELNFLSNKL-MNSNNHTTLFSSLLGYFSQILHRLPPLMNLFTGQRIATMLIDLDWYE 557
52547316  479 MTMPDMIKLSALLITLAGLAIGMELNSFTNKL-MNSMKHTTNFSNMLGYFTYFTHRIYPLMNLYSGQRIATMLIDMNWYE 557
56548744  477 MTMPSFMKQMALMVTTMGLMVGMELNSLTNNL-MKSNNHTNNFLTMLGFYTQIMHRIQPLISLFMGQRIATMLIDLNWYE 555
56548702  479 LTMPAIAKFSALLVSLLGLLMAMELNYMTTSLPVLSTMNLHNFSNMLGHFTLIFHRLNPLASLHAGRQTATMLIDLNWYE 558
221145545 482 MAMPMSTKLCALTVSILGIVIMLELSYLANNMHNISIKHSYYFSNSLGYFSFIFHRLNPMMSLLLGQHIATLLIDLNWFE 561
108793319 479 TTMPPMLKMSTLLVTITGLLIAMELNSLTNKLAAPPLKHAYNFSIMQGYFTHLLHRLLPLASLQMSQYIATMLMDLNWYE 558
166851901 561 KAMPKNLSHLQMLSSTMIS-NQTGLIKFYFLSFL--MSLLFTLLLF 603
5835048   559 KAGPKGQANVHSKLSSLISsSQKGLMKMYFLSFL--VSMIFIILFT 602
5836069   559 KSGPKGISSHQLTILTSVTeAQKGLMKIYFLSFLitPPIIITLLLF 604
18077893  559 KSGPKGISAQQMTFSSSITeTQKGLMKIYFLSFL--ITPLIIIMFF 602
45685716  558 KTGPKGQAYIHSTVSSLLTmAQKGSMKTYFLTFL--ISMMLTLALI 601
52547316  558 KTGPKGQTNIHSSMSSLLTsTQKGLIKVYFMSFL--ISITLALMFA 601
56548744  556 KAGPKGQANIHSKLSSLISaSQKGLMKMYFLSFL--VSIIFIILFT 599
56548702  559 KTGPQGLASTHSTISSYITaTQKGLLKTYFLSFV--ISILIIMMII 602
221145545 562 KTGPKGQTNLHTYSSSSITsTQKGMMKTYFLSFL--ISMILMLPIT 605
108793319 559 KIGPKNQMNIHTTMSSYISsTQKGLIKTYFLSFI--ISIPMMMILA 602
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap