Conserved Protein Domain Family
ND4L

?
MTH00107: ND4L 
NADH dehydrogenase subunit 4L; Provisional
Statistics
?
PSSM-Id: 177169
View PSSM: MTH00107
Aligned: 225 rows
Threshold Bit Score: 116.569
Threshold Setting Gi: 56548756
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
45686003   1 MASIYLNLMMAFLLALSGVLIYRSHLMSTLLCLEGMMLSLFIMMTLTISHFQMFSLSMAPLILLVFSACEAGIGLALLVK 80 
15079230   1 MSPAVLNITMAFTFSLLGTLMFRSHLMSTLLCLEGMMLSLFMLATITPLNTHSMIMFPIPIAILVFAACEAAVGLALLAK 80 
107736036  1 MTPAVINVSLAFAFSLLGTLVFRAHLMSTLLCLEGMMLSLFILATITPLNTHSMIMFPIPIIILVFAACEAAVGLALLAK 80 
218436975  1 MTSAFLNLTLAFMMSLLGTFMFRSHLMSTLLCLEGMMLSLFIMTSTSTLNSNSMISMTIPITILVFAACEAAVGLALLVK 80 
226453435  1 MTSAFLNLTLAFMMSLLGTFMFRSHLMSTLLCLEGMMLSLFIMTSTSTLNSNSMISMTIPITILVFAACEAAVGLALLVK 80 
226453500  1 MTSAFLNMTLAFMLSLLGTFMFRSHLMSTLLCLEGMMLSLFVMTSTSTLNSNSMISMTIPITILVFAACEAAVGLALLVK 80 
226464101  1 MTSAFLNLTLAFTLSLLGTLMFRSHLMSTLLCLEGMMLSLFIMASTSTLNSNSMVSMTIPITILVFAACEAAVGLALLAK 80 
255506347  1 MMTTVFNIILAFTFSLLGTLMFRSHLMSTLLCLEGMMLSLFIMTTITSLDSHSMIMYSIPIVILVFAACEAAVGLALLVK 80 
270267429  1 MTPAVINITLAFTFSLLGTLMFRSHLMSTLLCLEGMMLSLFIMATITPLNTHSMIMFPIPITILVFAACEAAVGLALLAK 80 
270267545  1 MTPAVFNITLAFTFSLLGTLMFRSHLMSTLLCLEGMMLSLFILATITPLNTHSMIMFPIPIVILVFAACEAAVGLALLAK 80 
45686003  81 TSNAHGNDHVQNLNLLQC 98 
15079230  81 ISNTYGSDFVQNLNLLQC 98 
107736036 81 ISNTYGSDFVHNLNLLQC 98 
218436975 81 ISNTYGTDYVQNLNLLQC 98 
226453435 81 ISNTYGTDYVQNLNLLQC 98 
226453500 81 ISNTYGTDYVQNLNLLQC 98 
226464101 81 ISNTYGTDYVQNLNLLQC 98 
255506347 81 ISNTYGTDYVQNLNLLQC 98 
270267429 81 ISNTYGSDMVHNLNLLQC 98 
270267545 81 ISNTYGTDFVQNLNLLQC 98 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap