Conserved Protein Domain Family
ND3

?
MTH00106: ND3 
NADH dehydrogenase subunit 3; Provisional
Statistics
?
PSSM-Id: 177168
View PSSM: MTH00106
Aligned: 236 rows
Threshold Bit Score: 148.164
Threshold Setting Gi: 159524418
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
167716872   1 MNVMLTLVTNVTLASLLVLIAFWLPQLNIYTDKTSPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWASQ 80 
21449883    1 MNLPLALTTSITLTLLLVTIAFWLPQLNVYTEKYSPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWASQ 80 
166851898   1 MNLPLALTTTIILTLLLVTIAFWLPQLNVYTEKYSPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWASQ 80 
14010673    1 MNTMIMLITNTSLASVLVLLAFWLPQLNIYTEKYSPYECGFDPTGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWAIQ 80 
238866842   1 MNTMLLLLVNTTLASIMVTVAFWLPQLNIYTEKYNPYECGFDPTGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWALQ 80 
238866856   1 MNTILLLTINATLASAMVMLAFWLPQLNIYTEKYSPYECGFDPTGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWALQ 80 
238866870   1 MNTMIMLITNTTLSSILVLVALWLPQLNIYTEKYSPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWALQ 80 
238866898   1 MNLPLALTTNIVLTLLLVTIAFWLPQLNVYTEKYSPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWASQ 80 
238866926   1 MNLPLALTTNIVLTLLLVTIAFWLPQLNVYTEKYSPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWASQ 80 
238866954   1 MNLPLALTTNIVLTLLLVTIAFWLPQLNIYTEKYSPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWAAQ 80 
167716872  81 TNKLTTMLIMALLLISLLAASLAYEWTEKGLEWTE 115
21449883   81 TNNLKLMLTVALVLITILAAGLAYEWLQKGLEWVE 115
166851898  81 TINPKLMLTVALILVSILAAGLAYEWLQKGLEWVE 115
14010673   81 THMLNLMLTMTFLLILILALGLAYEWIQKGLEWQE 115
238866842  81 SHTLILTLAMTLLLIMILALGLAYEWTQKGLEWEE 115
238866856  81 TYTLNLTLAMTLLLITILALGLAYEWTQKGLEWQE 115
238866870  81 THMLNLMLTVTLMLISILALGLTYEWLQKGLEWQE 115
238866898  81 TTNPKLMLAVALILVSILAAGLAYEWLQKGLEWVE 115
238866926  81 TTNPKLMLAVALILVSILAAGLAYEWLQKGLEWVE 115
238866954  81 TTKPNLMLTVALILISILAAGLAYEWLQKGLEWVE 115
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap