Conserved Protein Domain Family
ND2

?
MTH00105: ND2 
NADH dehydrogenase subunit 2; Provisional
Statistics
?
PSSM-Id: 177167
View PSSM: MTH00105
Aligned: 280 rows
Threshold Bit Score: 383.813
Threshold Setting Gi: 133755333
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5835640     1 MNPLAQLIIYTTVITGTLITMLSSHWFLAWAGLEMNMLAFIPTLIKKTNARSTEAATKYFLAQSTASMILMMAIISNNLL 80 
133755333   1 MNPILALFIYFMLTMGTIMVLISSHWLLIWMGFEMNLMAMIPIMMIKQNSRSTESAIKYFLVQTTASIMLMMSVSINLMM 80 
32526844    1 MNPILAYFIYYMLVMGTIMVLISSHWLLIWAGFEMNLMAMIPIMLYNQNPRSTESAIKYFMIQTTASIIFMMSVSINLML 80 
110189716   1 MNPITLIIIYFTILMGPVITMSSSNLLLMWVGLEMSLLAIIPLLANKKSPRSTEAATKYFLTQATASMIILLVIILNYKQ 80 
14530817    1 MNPVILTMAYFMIFMGSMIVFISSHWLVTWIGFEMNLMAMIPLMLVNKTPRSTEAATKYFITQASASMIFMFAVILNFML 80 
187373155   1 MNPMTLTIIYSTIFLGPVITMSSTNLLLMWVGLEFNLLAIVPLLMNKKNPRSTEAAMKYFITQATASMIILLAIVLNYKQ 80 
218436964   1 MNPITLIIIYFTIIMGPAITMSSSNLLLMWVGLEMSLLAIIPLLTNKKSPRSTEAATKYFLTQATASMIILLAIVLNYKQ 80 
226453424   1 MNPITLIIIYFTIFMGPAITMSSSNLLLMWVGLEMSLLAITPLLTNKKSPRSTEAATKYFLTQATASMIILLAIVLNYKQ 80 
226453489   1 MNPITLIIIYFTILVGPVITMSSSNLLLMWVGLEMSLLAIIPLLTNKKTPRSTEAATKYFLTQATASMIILLAIVLNYKQ 80 
226464090   1 MNPITLIIIYFTIFMGPVITMSSSNLLLMWVGLEVSLLAIVPLLTNKKSPRSTEAATKYFLTQATASMIMLLAIILNYKQ 80 
5835640    81 SGHWTTTTnYTNQFPPLAMTIALTMKLGMAPFHFWVPEVTQGTPLTSGLLLLTWQKLAPISIMYQIHPSINTHILLILST 160
133755333  81 TGQWTVTC-TNN-MLSSIITISMLMKLGAAPFHMWLPEVAQGLSLSSSMILLTWQKIAPMSVLYLLSPSLNIYIMFISAF 158
32526844   81 TGQWTVMY-INNSMLSTIITISMLMKLGAAPFHLWLPEVAQGLHLNSSMILLTWQKL-PLIYLYSLYSTLNFNIMIISAL 158
110189716  81 SGMWTLQQ-QTNNMLLNMMLISLAMKLGLAPFHYWLPEVTQGIPLHIGLILLTWQKIAPLSILYQFYQLLNPTITTILAI 159
14530817   81 YSQWNMLM-KLNPTSSLLLTMAMLMKLGMAPFHFWMPEVTQGVSLSTGMILLTWQKLAPLSIMYQILPSINYELIMTSAI 159
187373155  81 LGTWMFQQ-QTNSLILNMTLMALSMKLGLAPFHFWLPEVTQGIPLHMGLILLTWQKIAPLSILIQIYPLLNPTIILTMAI 159
218436964  81 SGMWTFQQ-QTNSMLFNMMLISLSMKLGLAPFHYWLPEVTQGIPMHIGLILLTWQKIAPLSMLYQIYQFLNPTITTILAI 159
226453424  81 SGMWTFQQ-QTNNMLLNMMLISLSMKLGLAPFHYWLPEVTQGIPMHIGLILLTWQKIAPLSMLYQIYQFLNPTITTILAI 159
226453489  81 SGMWMFQQ-QTNNILLNMMLISLSMKLGLAPFHYWLPEVTQGIPMHIGLILLTWQKIAPLSILYQIHQFLNPTITTILAI 159
226464090  81 SGMWMFQQ-QTNNMLLNMTLISLAMKLGLAPFHYWLPEVTQGIPMHTGLILLTWQKIAPLSILYQIYQLLNPTITTILAI 159
5835640   161 LSIAVGSWGGLNQTQLRKILGYSSITHTGWMMMTLTYNPTITTLYLITYITLTTTMFLTLNLNSSTTTLTLSNTWNKSTH 240
133755333 159 LSIALGGWGGLNQTQLRKMMAFSSIAHMGWMMAILCYNPNIMIINLIIYLMMTITLFYIFKNNSTTNIANLSLIWNKSPL 238
32526844  159 LSIVLGGWGGLNQTQLRKMMAFSSIAHMGWMMAVLCYNPNIMILNLFIYMIMTITLFMIFKYNSSTNISNLSLICNKSPI 238
110189716 160 SSVFVGAWGGLNQTQTRKIMAYSSIAHMGWMTAILPYNPNLTLLNLTIYILLTVPMFITLMTNSATTINTLSLAWNKTPM 239
14530817  160 MSILIGGWGGLNQLQLRKIMAYSSISNMGWMMAVLTYNPTLMILNLTVYIIITLTMFMYLNSYNITTTSMLSQLWNINTT 239
187373155 160 MSIFMGAWGGLNQTQMRKIMAYSSIAHMGWMLAILPYNPSLTLLNLAIYIILTIPMFMALMLNSSLTINSISLLWNKTPA 239
218436964 160 SSVLIGAWGGLNQTQTRKIMAYSSIAHMGWMVAILPHNPNLTLLNLTIYILLTIPMFITLMMSSATSINSLSLAWNKTPM 239
226453424 160 SSVLIGAWGGLNQTQTRKIMAYSSIAHMGWMVAILPHNPNLTLLNLTIYILLTIPMFTTLMMSSATSINSLSLAWDKTPM 239
226453489 160 SSVLIGAWGGLNQTQTRKIMAYSSIAHMGWMMAILPYNPNLTLLNLTIYILLTIPMFIMLMMNSATAINSLSLAWSKTPM 239
226464090 160 TSVFIGAWGGLNQTQTRKIMAYSSIAHMGWMVAILPYNPNLTLLNLVIYILLTIPMFISLMMNSATTINSFSMAWNKTPM 239
5835640   241 LMPLMTSTLLSLGGLPPLTGFLPKWVTIQELTMNNNFIIPTIMITMTLLNLYFYMRLIYTISLTLLPTSNNTKMTW-QFE 319
133755333 239 MALLLALILLSLGGLPPLTGFLPKWMVAQELVNNDNTIMALIMLMLALINLFFYLRLIYSSSLTMFPSMNNVKLNW-QYT 317
32526844  239 TASLLALMFMSLGALPPLTGFLPKWMVAQELIKNNNTMLALIMLMFALISLFFYMRLIYSTSLTMFPSTNNMKMYW-LYA 317
110189716 240 ILTMTSIILLSLGGLPPLTGFLPKWAIISELLKNNCSTLSTLMAIMALLSLFFYTRLIYSMSLTMFPTNNNSKMIShHHQ 319
14530817  240 FTIMMSLILLSLGGLPPLTGFIPKWLIIQEMTKNNNIILPTFMAMLTLINLLFYTRLIYSSSMTLFPSTSSSKLKW-HYK 318
187373155 240 VLMMTSLILLSLGGLPPLTGFLPKWIIITELMKNNCLIMATLMAMMALLNLFFYTRLIYSTSLTMFPTNNSSKMMI-HQT 318
218436964 240 ILAMASIILLSLGGLPPLTGFLPKWAIISELLKNNCSILSTLMAIMALLNLFFYTRLIYSMSLTMFPTNNNSKMIS-HHP 318
226453424 240 ILAMTSIILLSLGGLPPLTGFLPKWAIISELLKNNCSILSTLMAIMALLNLFFYARLIYSMSLTMFPTNNNSKMIS-HHP 318
226453489 240 ILAMASIILLSLGGLPPLTGFLPKWAIISELLKNNYLILPTLMAIMALLNLFFYTRLIYSMSLTMFPTNNNSKMIS-HHP 318
226464090 240 ILAMTSTILLSMGGLPPLTGFLPKWTIISELLKNDCSILSTLMAMMALLNLFFYTRLIYSMSLTMFPTNNNSKMIS-HHT 318
5835640   320 NTKPTLFIPALI-TISTLLLPISPLILSIP 348
133755333 318 KSNKYTLIIIILsVISILMLPLSPMFINFY 347
32526844  318 NSNNYSFITIIFsIMSIMMFPLMPILMNLY 347
110189716 320 NPKHNFILPTLT-VLSTLTLPLSSQLIT-- 346
14530817  319 TPKMNIMTPTLS-TLSILLLPLSPMFIIFT 347
187373155 319 KIKPNLMFSTLA-IISTMTLPLSPQMII-- 345
218436964 319 ILKYNFILPTLT-VLSTLTLPLSSQLMT-- 345
226453424 319 NLKYNFILPTLT-VLSTLTLPLSSQLMT-- 345
226453489 319 NLKHNFILPTLT-VLSTLTLPLSSQLMT-- 345
226464090 319 NLKYNLILPTLT-VLSTLTLPLSPQLTT-- 345
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap