Conserved Protein Domain Family
ND1

?
MTH00104: ND1 
NADH dehydrogenase subunit 1; Provisional
Statistics
?
PSSM-Id: 177166
View PSSM: MTH00104
Aligned: 232 rows
Threshold Bit Score: 496.068
Threshold Setting Gi: 156471193
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9801571     1 MFMINILTLIVPILLAVAFLTLVERKVLGYMQLRKGPNVVGPYGLLQPIADAIKLFTKEPLRPATSSITMFILAPILALT 80 
15055559    1 MFLANIILLILPVLLAMAFLTLVERKILGYMQLRKGPNVVGPYGLLQPFADAVKLFVKEPLRPLTSSPFLFTIAPTLALT 80 
5835527     1 MFLINTLLLILPVLLAMAFLTLVERKILGYMQLRKGPNIVGPYGLLQPIADAIKLFTKEPLRPLTSSPLLFIIAPTLALT 80 
21492445    1 MFLINTFLLILPVLLAMAFLTLVERKILGYMQLRKGPNIVGPYGLLQPIADAIKLFIKEPLRPLTSSSLLFIIAPTLALT 80 
41353096    1 MFLANIILLILPVLLAMAFLTLVERKILGYMQLRKGPNVVGPYGLLQPFADAVKLFVKEPLRPLTSSPFLFIIAPTLALT 80 
193290197   1 MFLANIILLILPVLLAMAFLTLVERKILGYMQLRKGPNVVGPYGLLQPFADAVKLFIKEPLRPLTSSPFLFIIAPTLALT 80 
91176203    1 MHMINILMLLVPILIAMAFLTLVERKILGYMQLRKGPNIVGPYGILQPFADAMKLFIKEPLRPLATSTTLFILAPTLSLT 80 
255506352   1 MHFINILMLLFPILVAMAFLTLVERKILGYMQLRKGPNIVGPYGILQPFADAMKLFVKEPLRPLATSTSLFIIAPTLSLT 80 
260150986   1 MHLINILMLLIPILIAMAFLTLVERKILGYMQLRKGPNIVGPYGILQPFADAMKLFIKEPLRPLATSTSLFIIAPTLSLM 80 
270267537   2 VYFINILTLLVPVLIAMAFLTLVERKILGYMQLRKGPNIVGPYGILQPFADAMKLFIKEPLRPLATSTTLFIIAPTLSLT 81 
9801571    81 LALTMWIPLSMPQPLVDMNLGVLFMLAMSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSVLLMNGSF 160
15055559   81 LALTMWIPIPMPYPLINMNMGILFILATSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLCILLMNGSF 160
5835527    81 LALSMWLPIPMPYPLVNLNMGILFILATSSLAVYSILWSGWASNSKYALFGALRAVAQTISYEVTLAIILLCILLMNGSF 160
21492445   81 LALSMWLPIPMPYPLVNLNMGVLFILATSSLAVYSILWSGWASNSKYALFGALRAVAQTISYEVTLAIILLCVLLMNGSF 160
41353096   81 LALTMWIPIPMPYPLINMNMGILFILATSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSILLMNGSF 160
193290197  81 LALTMWIPIPMPYPLINMNLGVLFILATSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSILLMNGSF 160
91176203   81 LAFSLWVPIPMPHPLINMNMGVLFILATSSLSVYSILWSGWASNSKYSMFGALRAVAQTISYEVTMAIILLSVLLMSGSF 160
255506352  81 LAFSLWIPLPMPHPLINMNMGVLFILATSSLSVYSILWSGWASNSKYSMFGALRAVAQTISYEVTLAIILLSVLLLSGSF 160
260150986  81 LAFSLWIPLPMPHPLINMNMGMLFILAISSLSVYSILWSGWASNSKYSMFGALRAIAQTISYEVTMAIILLSVLLMNGSF 160
270267537  82 LALSLWIPLPMPHPLVNLNLGILFILATSSLSVYSILWSGWASNSKYSMFGALRAVAQTISYEVTMAIILLSVLLMSGSF 161
9801571   161 TLSTLITTQEHMWMIIPAWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFAMFFMAEYANIIMMNAFTTI 240
15055559  161 TLSSLIDTQEYMWILIPAWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFLAEYTNIIMMNALTVT 240
5835527   161 TLSSLITTQEYMWILLPAWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAGGPFALFFLAEYTNIILMNALTAI 240
21492445  161 TLSSLITTQEYMWILFPAWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAGGPFALFFLAEYTNIIMMNALTTI 240
41353096  161 ALSSLIDTQEYMWILIPAWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFLAEYTNIIMMNALTVT 240
193290197 161 TLSSLIDTQEYMWILIPAWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFLAEYTNIIMMNALTVT 240
91176203  161 SLQTLITTQEHMWLLLASWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFMAEYTNIILMNALSTI 240
255506352 161 SLQALIVAQEPMWLLFTCWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFMAEYTNIILMNALSTI 240
260150986 161 SLQFLITTQEHTWLLLMSWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFMAEYTNIILMNALSTI 240
270267537 162 SIQALIYTQEPLWLLIPAWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFMAEYMNIILMNALSTI 241
9801571   241 LFFGAFHNPYMPELYTANFVLKTLLLTVTFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCMWHVSLPISTAGIpPPQT 319
15055559  241 LFLGAYHDTHNPQLFTINFAIKTLLLTMVFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCMWHVSMPVFLASI-PPYA 318
5835527   241 LFLGSFHSHTNPEMFTVNFATKTLLLTMTFLWIRASYPRFRYDQLMHLLWKSFLPLTLALCMWHISMPIMLSSI-PPQM 318
21492445  241 LFLGSFHSHTNPEMFTISFAAKTLLLTMTFLWIRASYPRFRYDQLMHLLWKSFLPLTLALCMWHISMPIMLSSI-PPHM 318
41353096  241 LFLGAFHDTHNPQLFTINFAIKTLLLTMVFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCMWHVSMPVFLAGI-PPYA 318
193290197 241 LFLGAFHDTLNPQLFTINFAAKTLLLTMAFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCMWHVSMPVSLAGI-PPYA 318
91176203  241 VFLGPYNNPTHPEMFTTNFMLKTLMLTSLFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCTWYISMPVFMASI-PPYT 318
255506352 241 IFLGPFHDPLNPELYTTNFVLKTLLLTSVFLWIRASYPRFRYDQLMQLLWKNFLPLTLALCMWHISLPICTASI-PPYT 318
260150986 241 VFLGPIHSLYLPHVYTTDFMIKTLMLTSLFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCTWHISIPIFMASI-PPYT 318
270267537 242 VFLGPFHNLHNPEFYTTNFMLKTLILTTLFLWIRASYPRFRYDQLMHLLWKNFLPLTLAFCMWHISIPIFMASI-PPYT 319
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap