Conserved Protein Domain Family
COX1

?
MTH00103: COX1 
cytochrome c oxidase subunit I; Validated
Statistics
?
PSSM-Id: 177165
View PSSM: MTH00103
Aligned: 229 rows
Threshold Bit Score: 901.172
Threshold Setting Gi: 62161143
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
45685694    1 MFINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLIGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGN 80 
5835823     1 MFADRWLFSTNHKDIGTLYLLFGAWAGVLGTALSLLIRAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGN 80 
5835170     1 MFADRWLFSTNHKDIGTLYLLFGAWAGVLGTALSLLIRAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPMMIGGFGN 80 
5835837     1 MFADRWLFSTNHKDIGTLYLLFGAWAGVLGTALSLLIRAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGN 80 
14010682    1 MFMNRWLFSTNHKDIGTLYLMFGAWAGATGTALSLLIRAELGQPGSLMEDDHVYNVIVTSHAFIMIFFMVMPIMIGGFGN 80 
292606411   1 MFADRWLFSTNHKDIGTLYLLFGAWAGVLGTALSLLIRAELGQPGSLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGN 80 
295065483   1 MFADRWLFSTNHKDIGTLYLLFGAWAGVLGTALSLLIRAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGN 80 
295065513   1 MFADRWLFSTNHKDIGTLYLLFGAWAGVLGTALSLLIRAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGN 80 
295065541   1 MFADRWLFSTNHKDIGTLYLLFGAWAGVLGTALSLLIRAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGN 80 
295065583   1 MFADRWLFSTNHKDIGTLYLLFGAWAGVLGTALSLLIRAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGN 80 
45685694   81 WLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSTVEAGAGTGWTVYPPLAGNLAHAGASVDLAIFSLHLAGISSILG 160
5835823    81 WLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSSILG 160
5835170    81 WLVPLMIGAPDMAFPRMNNMSFWLLLPSFLLLLASATVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGISSILG 160
5835837    81 WLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASATVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGISSILG 160
14010682   81 WLVPLMIGAPDMAFPRMNNMSFWLLPPSLLLLLASSTLEAGVGTGWTVYPPLAGNMSHPGASVDLTIFSLHLAGISSILG 160
292606411  81 WLIPLMIGAPDMAFPRMNNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGISSILG 160
295065483  81 WLIPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSSILG 160
295065513  81 WLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSSILG 160
295065541  81 WLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSSILG 160
295065583  81 WLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSSILG 160
45685694  161 AINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGH 240
5835823   161 AINFITTIINMKPPAMSQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGH 240
5835170   161 AINFITTIINMKPPAMSQYQTPLFVWSILITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGH 240
5835837   161 AINFITTIINMKPPAMSQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGH 240
14010682  161 AINFITTIINMKPPATTQYQTPLFVWSVLITAILLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGH 240
292606411 161 AINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGH 240
295065483 161 AINFITTIINMKPPAMSQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPSGGGDPILYQHLFWFFGH 240
295065513 161 AINFITTIINMKPPAMSQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGH 240
295065541 161 AINFITTIINMKPPAMSQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGH 240
295065583 161 AINFITTIINMKPPAMSQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGH 240
45685694  241 PEVYILILPGFGIISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGLDVDTRAYFTSATMIIAIPTGVKV 320
5835823   241 PEVYILILPGFGMISHIVTHYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKV 320
5835170   241 PEVYILILPGFGMISHIVTHYSGKKEPFGYMGMVWAMVSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKV 320
5835837   241 PEVYILILPGFGMISHIVTHYSGKEEPFGYMGMVWAMVSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKV 320
14010682  241 PEVYILILPGFGMISHIVTYYSNKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKV 320
292606411 241 PEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKV 320
295065483 241 PEVYILILPGFGMISHIVTHYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKV 320
295065513 241 PEVYILILPGFGMISHIVTHYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKV 320
295065541 241 PEVYILILPGFGMISHIVTHYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKV 320
295065583 241 PEVYILILPGFGMISHIVTHYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKV 320
45685694  321 FSWLATLHGGNIKWSPAMLWALGFIFLFTIGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLF 400
5835823   321 FSWLATLHGSDTKWSAAVLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLF 400
5835170   321 FSWLATLHGSNTKWSAAILWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFIHWFPLF 400
5835837   321 FSWLATLHGSNTKWSAAILWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFIHWFPLF 400
14010682  321 FSWLATLHGGNIKWSPAMLWALGFIFLFTVGGLTGVVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFIHWFPLF 400
292606411 321 FSWLATLHGSNMKWSAAVLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFIHWFPLF 400
295065483 321 FSWLATLHGSDTKWSAAVLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLF 400
295065513 321 FSWLATLHGSDTKWSAAVLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLF 400
295065541 321 FSWLATLHGSDTKWSAAVLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLF 400
295065583 321 FSWLATLHGSDTKWSAAVLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLF 400
45685694  401 TGYMLSDMWAKIHFFIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTTWNIMSSIGSFISLTAVILMLFIIWEAFASKR 480
5835823   401 SGYTLDQTYAKIHFAIMFVGVNLTFFPQHFLGLSGMPRRYSDYPDAYTTWNILSSVGSFISLTAVMLMIFMIWEAFASKR 480
5835170   401 SGYTLNQTYAKIHFITMFVGVNLTFFPQHFLGLSGMPRRYSDYPDAYTTWNILSSAGSFISLTAVMLMIFMIWEAFASKR 480
5835837   401 SGYTLDQTYAKIHFITMFIGVNLTFFPQHFLGLSGMPRRYSDYPDAYTTWNILSSAGSFISLTAVMLMIFMIWEAFASKR 480
14010682  401 SGYTLDQTYAKIHFTIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTAWNIISSVGSFISLAAVILMIFMIWEAFSSKR 480
292606411 401 SGYTLDQTYAKIHFAIMFIGVNLTFFPQHFLGLSGMPRRYSDYPDAYTTWNILSSAGSFISLTAVMLMIFMIWEAFASKR 480
295065483 401 SGYTLDQTYAKIHFAIMFVGVNLTFFPQHFLGLSGMPRRYSDYPDAYTTWNVLSSVGSFISLTAVMLMIFMVWEAFASKR 480
295065513 401 SGYTLDQTYAKIHFVIMFVGVNLTFFPQHFLGLSGMPRRYSDYPDAYTTWNILSSVGSFISLTAVMLMIFMIWEAFASKR 480
295065541 401 SGYTLDQTYAKIHFAIMFVGVNLTFFPQHFLGLSGMPRRYSDYPDAYTTWNILSSVGSFISLTAVMLMIFMIWEAFASKR 480
295065583 401 SGYTLDQTYAKIHFAIMFVGVNLTFFPQHFLGLSGMPRRYSDYPDAYTTWNILSSVGSFISLTAVMLMIFMVWEAFASKR 480
45685694  481 EVSSVELTTTNIEWLYGCPPPYHTFEQPVFVKS 513
5835823   481 KILMIEQPSTNLEWLYGCPPPYHTFEEPVYMKP 513
5835170   481 KVPMIEQPSTSLEWLYGCPPPYHTFEEPVYMKP 513
5835837   481 KVPMVEQPSTSLEWLYGCPPPYHTFEEPVYMKP 513
14010682  481 KVLTIEQMSTNLEWLYGCPPPYHTFEEATYGKT 513
292606411 481 KVLMVEEPSMNLEWLYGCPPPYHTFEEPVYMKS 513
295065483 481 KVLMIEQPSTNLEWLYGCPPPHHTFEEPVYMKP 513
295065513 481 KILMIEQPSTNLEWLYGCPPPYHTFEEPVYMKP 513
295065541 481 KILMIEQPSTNLEWLYGCPPPYHTFEEPVYMKP 513
295065583 481 KILMIEQPSTNLEWLYGCPPPYHTFEEPVYMKP 513
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap