Conserved Protein Domain Family
ATP6

?
MTH00101: ATP6 
ATP synthase F0 subunit 6; Validated
Statistics
?
PSSM-Id: 177163
View PSSM: MTH00101
Aligned: 237 rows
Threshold Bit Score: 274.522
Threshold Setting Gi: 14010685
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
42632235    1 MNENLFASFATPTmMMGLPIVVLIILFPSILFPTPNRLINNRLVSLQQWLIQLTSKQMMAIHNQKGQTWTLMLISLILFI 80 
57634826    1 MNEELSTFFYVPV-----GTMMLAIAFPAILLPTPNRLITNRWITIQQWLIQLIMKQLLSIHNTKGLSWSLMLITLTLFI 75 
148922592   1 MNEGLSTFFDVPM-----GTMTLIVAFPAILLPTTNRLITNRLVTIQQWLIQLIMKQLLTIHNTKGLSWSLMLITLTLFI 75 
81230407    1 MNEELSAFFDVPV-----GTMMLAIAFPAILLPTPNRLITNRWITIQQWLVKLIMKQLLSIHNTKGLSWSLMLITLTLFI 75 
107122078   1 MNEELSAFFDVPV-----GTMMLAIAFPAILLPTPNRLITNRWITIQQWLIQLIMKQLLSIHNMKGLSWSLMLITLTLFI 75 
14010685    1 MNQNLFASFNMPM-ILGIPLVALFILFPTMLITPSNNLNNNRSSSLQQWLIQLVLKQMMTNHTTKGQTWSLMLLTLITFI 79 
295065486   1 MNENLFASFATPT-ILGLPAAVPIILFPSLLIPTSKYLINNRLITTQQWLIQLTLKQMMAMHNTKGRTWSLMLISLITFI 79 
295065516   1 MNENLFAPFATPT-ILGLPAAVPIILFPSLLVPTSKYLINNRLIATQQWLIQLTLKQMMTVHSTKGRTWSLMLISLITFI 79 
295065544   1 MNENLFASFAAPT-ILGLPAAVPIILFPSLLIPTSKYLINNRLITTQQWLIQLTLKQMMTLHNTKGRTWSLMLISLIIFI 79 
295065586   1 MNENLFASFAAPT-ILGLPAAVPIILFPSLLIPTSKYLINNRLVTTQRWLIQLTLKQMMTMHNAKGRTWSLMLISLITFI 79 
42632235   81 GSTNLLGLLPHSFTPTTQLSMNLGMAIPLWAGTVITGFRYKTKASLAHFLPQGTPLPLIPMLIIIETISLFIQPMALAVR 160
57634826   76 GLTNLLGLLPYSFAPTTQLTVNLSMAIPLWTGTVVPGFRYKTKISLAHLLPQGTPMFLIPMIIIIETISLLIRPVTLAVR 155
148922592  76 GLTNLLGLLPYSFTPTTQLAMNLSMAIPLWTGTVILGLRHKTKVSLAHLLPQGTPTFLIPMIIVIETISLLIRPITLAVR 155
81230407   76 GLTNLLGLLPYSFAPTAQLTVNLSMAIPLWTGTVILGFRYKTKISLAHLLPQGTPTFLIPMIIIIETISLLIRPVTLAVR 155
107122078  76 GLTNLLGLLPYSFAPTTQLTVNLSMAIPLWTGTVVLGFRYKTKISLAHLLPQGTPTFLIPMIIIIETISLLIRPITLAVR 155
14010685   80 TLNNLLGITPYAFTPTTQLSLNLGMAIPLWMATVLMGLRFKTKATLAHLLPQGTPIPLIPMLIIIETISLFIQPMALAVR 159
295065486  80 ATTNLLGLLPHSFTPTTQLSMNLAMAIPLWAGTVATGLRLKAKNTLAHLLPQGTPTPLIPMLIIIETISLFIQPVALAVR 159
295065516  80 ATTNLLGLLPHSFTPTTQLSMNLAMAVPLWAGTVATGLRLKTKNTLAHLLPQGTPTPLIPMLIIIETISLFIQPVALAVR 159
295065544  80 ATTNLLGLLPHSFTPTTQLSMNLAMAIPLWAGTVATGLRLKTKNTLAHLLPQGTPTPLIPMLIIIETISLFIQPMALAVR 159
295065586  80 ATTNLLGLLPHSFTPTTQLSMNLAMAIPLWAGTVATGFRLKAKNTFAHLLPQGTPTPLIPMLIIIETISLFIQPMALAVR 159
42632235  161 LTANITAGHLLIHLIGGATLVLMSISPITAFITFIILVMLTVLEFAVALIQAYVFTLLVSLYLHDNT 227
57634826  156 LTANITAGHSLIHLTGTATLTLSSIHSMTITVTFVTVILLTILELAVALIQAYVFALLISLYLHENA 222
148922592 156 LTANITAGHLLIHLTGTATLTLLSIHPMTITVTFITMILLTILELAVALIQAYVFALLVSLYLYENA 222
81230407  156 LTANITAGHLLIHLTGTAALTLLSIHSMTITVTFITVVVLTILELAVALIQAYVFALLISLYLHESA 222
107122078 156 LTANITAGHLLIHLTGSAALTLLSVHLMTITVTFITVVMLTILELAVALIQAYVFALLISLYLHESA 222
14010685  160 LTANITAGHLLMHLLGDTMLILLSIYLSSSVITVIVIILLITLELGVALIQAYVFTLLVSLYLHNNS 226
295065486 160 LTANITAGHLLMHLIGAATMALSTISPPMTPIIFTVLALLTILEIAVALIQAYVFTLLVSLYLHDNT 226
295065516 160 LTANITAGHLLMHLIGAATLALSTISLPATPIIFTILALLTILEIAVALIQAYVFTLLVSLYLHDNT 226
295065544 160 LTANITAGHLLMHLIGAATLALSTISLPMTPIIFTILALLTILEIAVALIQAYVFTLLVSLYLHDNT 226
295065586 160 LTANITAGHLLMHLIGAATLALSTISLSATPIIFTVLALLTILEVAVALIQAYVFTLLVSLYLHDNT 226
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap