Conserved Protein Domain Family
CYTB

?
MTH00100: CYTB 
cytochrome b; Provisional
Statistics
?
PSSM-Id: 177162
View PSSM: MTH00100
Aligned: 238 rows
Threshold Bit Score: 685.601
Threshold Setting Gi: 156471218
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
167716849   1 MTNMRKTHPLFKIINHSFIDLPAPSNISSWWNFGSLLGICLMVQIITGLFLAMHYTSDTMTAFSSVTHICRDVNYGWLIR 80 
156471218   1 MTPMRKSNPIMKMINHSLIDLPTPSNISMWWNFGSLLAFCLILQIVTGLFLAMHYSPDTSSAFSSIAHITRDVNHGWIIR 80 
156471204   1 MTPMRKSNPIMKMINHSLIDLPTPSNISMWWNFGSLLAFCLILQIITGLFLAMHYSPDTSSAFSSIAHITRDVNHGWIIR 80 
62161266    1 MTPLRKSNPIMKMINHSLIDLPTPSNISTWWNFGSLLATCLTLQIITGLFLAMHYSPDTSSAFSSIAHITRDVNYGWIIR 80 
66276043    1 MTPMRKSNPIMKMINHSLIDLPTPSNISMWWNFGSLLAFCLILQIITGLFLAMHYSPDTSSAFSSIAHITRDVNHGWIIR 80 
107736089   1 MTPMRKSNPIMKMINHSLIDLPTPSNISMWWNFGSLLAFCLILQIITGLFLAMHYSPDTSSAFSSIAHITRDVNHGWIIR 80 
109689566   1 MIPMRKSNPIMKLINHSLIDLPTPSNISAWWNFGSLLAICLILQIITGLFLAMHYSPSTSSAFSSIAHITRDVNYGWIIR 80 
14010692    1 MTSPRKTHPLMKIINSSFIDLPTPSNISSWWNFGSLLGACLMIQITTGLFLAMHYTPDTSTAFSSVAHITRDINYGWMIR 80 
109689552   1 MTPTRKSNLIMKMINHSLIDLPTPSNISMWWNFGSLLATCLILQIITGLFLAMHYSPDTSSAFSSIAHITRDVNYGWIIR 80 
109689580   1 MTPMRKSNLIMKMINHSLIDLPTPSNISAWWNFGSLLATCLMLQIITGLFLAMHYSPDTSSAFSSIAHITRDVNYGWTIR 80 
167716849  81 YMHANGASMFFICLFLHVGRGLYYGSYTFMETWNIGVLLLFAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTL 160
156471218  81 YLHANGASMFFICLFLHVGRGLYYGSFLLLKTWNTGIMLLFLTMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDL 160
156471204  81 YLHANGASMFFICLFLHVGRGLYYGSFLLLKTWTTGIMLLFLTMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDL 160
62161266   81 YLHANGASMFFICLFLHVGRGLYYGSFLLTETWNIGIALLLMTMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTNL 160
66276043   81 YLHANGASMFFICLFLHVGRSLYYGSFLLLKTWNTGIMLLFLTMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDL 160
107736089  81 YLHANGASMFFICLFLHVGRGLYYGSFLLLKTWNTGIMLLFLTMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDL 160
109689566  81 YLHANGASMFFICLFLHVGRGLYYGSFLLLETWNIGIALLLMVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTNL 160
14010692   81 LLHANGASMFFVCLFLHTGRGLYYGSFLFLNTWNIGTILLLMTMATAFMGYVLPWGQMSFWGATVITNLLSAIPYTGHNL 160
109689552  81 YLHANGASMFFICLFLHVGRGLYYGSFLLLETWNIGVTLLLMIMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTNI 160
109689580  81 YLHANGASMFFICLFLHVGRGLYYGSFLLVETWNIGIALLFMIMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTNI 160
167716849 161 VEWIWGGFSVDKATLTRFFAFHFILPFIIAALAIVHLLFLHETGSNNPTGLNSDADKIPFHPYYTIKDILGILIMFLILM 240
156471218 161 VQWIWGGYSIGNPTLSRFFTLHFILPFIITTLTTVHLLFLHETGSNNPCGISSDSDKITFHPYYTIKDILGLILLLFILT 240
156471204 161 VQWIWGGYSIGNPTLSRFFTLHFILPFIITALTTVHLLFLHETGSNNPCGISSNSDKIAFHPYYTIKDILGLILLLFTLT 240
62161266  161 VQWVWGGYSIDNPTLTRFFTLHFTLPFIIATLTALHLLFLHETGSNNPCGIPSNSDKIPFHPYYTIKDILGLIFLLLILM 240
66276043  161 VQWVWGGYSIGNPTLSRFFTLHFTLPFIITALTTVHLLFLHETGSNNPCGISSDSDKITFHPYYTIKDILGLILLLFILT 240
107736089 161 VQWIWGGYSIGNPTLSRFFTLHFILPFIITALTMVHLLFLHETGSNNPCGISSDSDKIPFHPYYTIKDILGLVLLLFILT 240
109689566 161 VQWVWGGYSIDNPTLTRFFTLHFTLPFIITAFTVLHLLFLHETGSNNPCGIPSNSDKIPFHPYYTIKDMLGLVLLILLLM 240
14010692  161 VQWIWGGFSVDKPTLTRFFTFHFILPFIITALATIHLLFLHETGSNNPSGMASSPDKIMFHPYYTTKDIFGLTLLLLLLT 240
109689552 161 VQWVWGGYSIDSPTLTRFFTFHFTLPFIIAALTTLHLLFLHETGSNNPCGIPSNPDKIPFHPYYTIKDILGLILLLLILM 240
109689580 161 VQWVWGGYAIDNPTLTRFFTLHFTLPFIIAAFTTLHLLFLHETGSNNPCGIPSNPDKIPFHPYYTIKDILGLTFLLLTLM 240
167716849 241 TLVLFFPDMLGDPDNYMPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALVLSILILALMPFLHTSKQRSLMFRPI 320
156471218 241 TLTLLSPDLLNDPDNYTPADPLNTPPHIKPEWYFLFAYAILRSVPNKLGGVLALFLSILILSIIPMLHNSKQQSMMFRPL 320
156471204 241 TLTLLSPDLPNDPDNYIPADPLNTPPHIKPEWYFLFAYAILRSVPNKLGGVLALFLSILILSIIPMLHNSKQQSMMFRPL 320
62161266  241 TLVLFSPDLLSDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSVPNKLGGVLALLLSILILAIMPVLHKSKQQSMAFRPL 320
66276043  241 ALTLLSPDLLNDPDNYTPADPLNTPPHIKPEWYFLFAYAILRSVPNKLGGVLALFLSILILSIIPMLHNSKQQSMMFRPL 320
107736089 241 TLTLLSPNLLNDPDNYIPADPLNTPPHIKPEWYFLFAYAILRSVPNKLGGVLALFLSILILSIIPTLHNSKQQSMMFRPL 320
109689566 241 TLVLFSPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSVPNKLGGVLALLMSILILMIIPMLHKSKQQSMMFRPF 320
14010692  241 SLTLFTPDLLTDPDNYTLANPLNTPPHIKPEWYFLFAYTILRSIPNKLGGVLALLLSIMILTIIPATHLSKQQSMMFRPI 320
109689552 241 VLVLFLPDLLGDPDNYTPANPLSTPPHIKPEWYFLFAYAILRSVPNKLGGVLALLMSILILMIIPMLHKSKQQSMMFRPL 320
109689580 241 VLVLFLPDLLSDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSVPNKLGGVLALLMSILILAIIPALHKSKQQSMMFRPF 320
167716849 321 TQILYWILVANLLILTWIGGQPVEHPFIIIGQLASISYFSIILILMPISGIIEDKMLKL 379
156471218 321 SQFLFWLLITTLLTLTWIGSQPVSQPFILIGQLASMTYFATILILMPLTSLIENNLLKW 379
156471204 321 SQFLFWLLIATLLTLTWIGSQPVSQPFILIGQLASMTYFTTILILMPLTSLIENNLLKW 379
62161266  321 SQFLLWLLITTLLTLTWIGSQPVNQPFIMIGQVASMLYFTTILILMPLASLIENNLLKW 379
66276043  321 SQFLFWLLITTLLTLTWIGSQPVSQPFILIGQLASMTYFTTILILMPLTSLIENNLLKW 379
107736089 321 SQFLFWFLITTLLTLTWIGSQPVSQPFIFIGQLASTMYFTTVLILMPLTSLIENNLLKW 379
109689566 321 SQFTLWLLITVLLTLTWIGSQPVNQPFIMIGQVASMMYFTTILILMPLASMIENNLLK- 378
14010692  321 TQILFWTLAADLLTLTWIGGQPVEYPFEAIGQTASIAYF-LIITLIPLSALTENKLLKW 378
109689552 321 SQLVLWFLITILLTLTWIGSQPVNQPFIMIGQTASMMYFITILILMPLASSIENNLLK- 378
109689580 321 SQFLLWLLVTILLTLTWIGSQPVNQPFIMIGQMMSMMYFTTILILMPLASLTENNLLK- 378
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap