Conserved Protein Domain Family
COX3

?
MTH00099: COX3 
cytochrome c oxidase subunit III; Validated
Statistics
?
PSSM-Id: 177161
View PSSM: MTH00099
Aligned: 231 rows
Threshold Bit Score: 440.317
Threshold Setting Gi: 156471198
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
156471212   1 MTHQSHAYHMVKPSPWPLTGALSALLTTSGLAMWFHFYSTTLLTLGLLTMTLTLHQWWRDIVRESTYQGHHTTPVQKNLR 80 
5835841     1 MAHQSHAYHMVKPSPWPLTGALSALLTTSGLTMWFHFHSTTLLLTGLLTNALTMYQWWRDVVRESTYQGHHTLPVQKGLR 80 
5835144     1 MAHQSHAYHMVKPSPWPLTGALSALLMTSGLAMWFHFYSTTLLTLGLLTNTLTMYQWWRDVMRESTYQGHHTPPVQKGLR 80 
5835159     1 MIHQSHAYHMVKPSPWPLTGALSALLMTSGLAMWFHFHSTTLLMLGLLTNMLTMYQWWRDVMRESTYQGHHTLPVQKGLR 80 
5835172     1 MVHQSHAYHMLKPSPWPLTGALSALLMTSGLAMWFHFHSTTLLLTGMLTNALTMYQWWRDVVRESTYQGHHTLPVQKGLR 80 
195952361   1 MIHQSHAYHMVKPSPWPLTGALSALLMTSGLAMWFHFHSTTLLMLGLLTNMLTMYQWWRDVMRESTYQGHHTLPVQKGLR 80 
14010686    1 MTHQTHAYHMVNPSPWPLTGALSAFLLTSGLVMWFHFYYTPLFNAGLLASAMTMAQWWRDVVRESTYQGHHTMPVQKGLR 80 
196123585   1 MTHQSHAYHMVKPSPWPLTGALSALLMTSGLAMWFHFHSTTLLMLGLLTNTLTMYQWWRDVTRESTYQGHHTPPVQKGLR 80 
251831113   1 MTHQSHAYHMVKPSPWPLTGALSALLMTSGLAMWFHFHSMTLLMLGLLTNTLTMYQWWRDVTRESTYQGHHTPPVQKGLR 80 
292606415   1 MTHQSHAYHMVKPSPWPLTGALSALLMTSGLTMWFHFHSTTLLMLGLLTNTLTMYQWWRDVTRESTYQGHHTPPVQKGLR 80 
156471212  81 YGMALFIISEVFFFTGFFWAFYHSSLAPTPYLGGHWPPTGITPLNPLEVPLLNTSVLLASGVTITWAHHSLMNNNRKQTT 160
5835841    81 YGMILFITSEVFFFAGFFWAFYHSSLAPTPQLGGHWPPTGIIPLNPLEVPLLNTSVLLASGVSITWAHHSLMENNRTQMI 160
5835144    81 YGMILFITSEVFFFAGFFWAFYHSSLAPTPQLGGHWPPTGITPLNPLEVPLLNTSVLLASGVSITWAHHSLMENNRNQMI 160
5835159    81 YGMILFITSEVFFFAGFFWAFYHSSLAPTPQLGAHWPPTGITPLNPLEVPLLNTSVLLASGVSITWAHHSLMENNRNQMI 160
5835172    81 YGMILFITSEVFFFAGFFWAFYHSSLAPTPQLGGHWPPTGITPLNPLEVPLLNTAVLLASGVSITWAHHSLMENNRTQMI 160
195952361  81 YGMILFITSEVFFFAGFFWAFYHSSLAPTPQLGAHWPPTGITPLNPLEVPLLNTSVLLASGVSITWAHHSLMENNRNQMI 160
14010686   81 YGMILFIISEVFFFAGFFWAFYHSSLAPTPQTGGHWPPTGIFPLNPMEVPLLNTAVLLASGVTITWAHHSLMEANQENST 160
196123585  81 YGMVLFITSEVFFFAGFFWAFYHSSLAPTPQLGGHWPPTGITPLNPLEVPLLNTSVLLASGVSITWAHHSLMENNRNQMI 160
251831113  81 YGMILFITSEVFFFAGFFWAFYHSSLAPTPQLGGHWPPTGITPLNPLEVPLLNTSVLLASGVSITWAHHSLMENNRNQMI 160
292606415  81 YGMILFITSEVFFFAGFFWAFYHSSLAPTPQLGGHWPPTGITPLNPLEVPLLNTSVLLASGVSITWAHHSLMENNRNQMI 160
156471212 161 QALLITILLGIYFTLLQISEYFEAPFTISDGIYGSTFFIATGFHGLHVIIGSTFLLVCLIRQLLYHFTPNHHFGFEAAAW 240
5835841   161 QALLITILLGIYFTLLQASEYIEAPFTISDGIYGSTFFMATGFHGLHVIIGSTFLTVCLARQLLFHFTSKHHFGFEAAAW 240
5835144   161 QALLITILLGLYFTLLQASEYFESPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICLIRQLMFHFTSKHHFGFEAAAW 240
5835159   161 QALLITILLGLYFTLLQASEYFEAPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICLIRQLMFHFTSKHHFGFEAAAW 240
5835172   161 QALLITILLGIYFTLLQASEYIEAPFTISDGIYGSTFFMTTGFHGLHVIIGSTFLTVCLSCQLLFHFTSKHHFGFEAAAW 240
195952361 161 QALLITILLGLYFTLLQASEYFEAPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICLIRQLMFHFTSKHHFGFEAAAW 240
14010686  161 QALSLTIALGIYFTYLQVSEYSETPFSISDGIYGSTFFMATGFHGLHVIIGTTFLATCYIRQQLYHFTPNHHFGFEAAAW 240
196123585 161 QALLITILLGLYFTLLQASEYFESPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICFIRQLMFHFTSKHHFGFEAAAW 240
251831113 161 QALLITILLGLYFTLLQASEYFESPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICFIRQLMFHFTSKHHFGFEAAAW 240
292606415 161 QALLITILLGLYFTLLQASEYFESPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICFIRQLMFHFTSKHHFGFEAAAW 240
156471212 241 YWHFVDVVWLLLYISIYWWGS 261
5835841   241 YWHFVDVVWLFLYVSIYWWGS 261
5835144   241 YWHFVDVVWLFLYVSIYWWGS 261
5835159   241 YWHFVDVVWLFLYVSIYWWGS 261
5835172   241 YWHFVDVVWLFLYVSIYWWGS 261
195952361 241 YWHFVDVVWLFLYVSIYWWGS 261
14010686  241 YWHFVDVVWLFLYISIYWWGS 261
196123585 241 YWHFVDVVWLFLYVSIYWWG- 260
251831113 241 YWHFVDVVWLFLYVSIYWWGS 261
292606415 241 YWHFVDVVWLFLYISIYWWGS 261
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap