Conserved Protein Domain Family
COX2

?
MTH00098: COX2 
cytochrome c oxidase subunit II; Validated
Statistics
?
PSSM-Id: 177160
View PSSM: MTH00098
Aligned: 239 rows
Threshold Bit Score: 369.047
Threshold Setting Gi: 229772914
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
49146239    1 MAHPVQLSLQDATSPVMEELITFHDHAFMAMSLISFLVLYALLSTLTTKLTNTSITDAQEMETIWTILPAIILILIALPS 80 
5835164     1 MAHAAQVGLQDATSPIMEELVIFHDHALMIIFLICFLVLYALFLTLTTKLTNTNISDAQEMETIWTILPAIILILIALPS 80 
5835824     1 MAHATQVGLQDATSPIMEELISFHDHALMIIFLISFLVLYALFLTLTTKLTNTNITDAQEMETVWTILPAIILVLIALPS 80 
5835838     1 MAHAAQVGLQDATSPIMEELVIFHDHALMIIFLICFLVLYALFLTLTTKLTNTSISDAQEMETIWTILPAIILILIALPS 80 
5835150     1 MAHAAQVGLQDATSPIMEELIIFHDHALMIIFLICFLVLYALFLTLTTKLTNNNISDAQEMETIWTILPAIILVLIALPS 80 
195952358   1 MAHAAQVGLQDATSPIMEELIIFHDHALMIIFLICFLVLYALFLTLTTKLTNTNISDAQEMETIWTILPAIILVLIALPS 80 
251831110   1 MAHAAQVGLQDATSPIMEELITFHDHALMIIFLICFLVLYALFLTLTTKLTNTNISDAQEMETVWTILPAIILVLIALPS 80 
295065484   1 MAHATQVGLQDATSPIMEELISFHDHALMIIFLISFLVLYALFLTLTTKLTNTNITDAQEMETIWTILPAIILVLIALPS 80 
295065514   1 MAHATQVGLQDATSPIMEELISFHDHALMIIFLISFLVLYALFLTLTTKLTNTNITDAQEMETVWTILPAIILVLIALPS 80 
295065542   1 MAHAAQVGLQDATSPIMEELISFHDHALMIIFLISFLVLYALFLTLTTKLTNTNITDAQEMETVWTILPAIILVLIALPS 80 
49146239   81 LRILYLTDEVNDPSFTIKSIGHQWYWTYEYTDYGSLIFNSYMLPPLFLNPGDLRLLEVDNRVVLPIEAPVRMMITSQDVL 160
5835164    81 LRILYLTDEINDPSFTIKSIGHQWYWTYEYTDYGGLIFNSYMLPPLFLEPGDLRLLDVDNRVVLPVEAPVRMMITSQDVL 160
5835824    81 LRILYLTDEINDPSFTIKAIGHQWYWAYEYTDYGGLIFNSYMLPPLFLEPGDLRLLEVDNRVVLPIEAPVRMMITSQDVL 160
5835838    81 LRILYLTDEINDPSFTIKSIGHQWYWTYEYTDYGGLIFNSYMLPPLFLEPGDLRLLDVDNRVVLPVEAPVRMMITSQDVL 160
5835150    81 LRILYMTDEINDPSFTIKSIGHQWYWTYEYTDYGGLIFNSYMLPPLFLEPGDLRLLDVDNRVVLPVEAPVRMMITSQDVL 160
195952358  81 LRILYMTDEINDPSFTIKSIGHQWYWTYEYTDYGGLIFNSYMLPPLFLEPGDLRLLDVDNRVVLPVEAPVRMMITSQDVL 160
251831110  81 LRILYMTDEVNDPSLTIKSIGHQWYWTYEYTDYGGLIFNSYMLPPLFLEPGDLRLLDVDNRVVLPIEAPIRMMITSQDVL 160
295065484  81 LRILYLTDEINDPSFTIKAIGHQWYWAYEYTDYGGLIFNSYMLPPLFLEPGDLRLLEVDNRVVLPIEAPVRMMITSQDVL 160
295065514  81 LRILYLTDEINDPSFTIKAIGHQWYWAYEYTDYGGLIFNSYMLPPLFLEPGDLRLLEVDNRVVLPIEAPVRMMITSQDVL 160
295065542  81 LRILYLTDEINDPSFTIKAIGHQWYWAYEYTDYGGLIFNSYMLPPLFLEPGDLRLLEVDNRVVLPIEAPVRMMITSQDVL 160
49146239  161 HSWTIPTLGLKTDAVPGRLNQTVFTATRPGVYYGQCSEICGANHSFMPIVAELIPLKIFEMGPVFTL 227
5835164   161 HSWTVPSLGLKTDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEMGPVFAL 227
5835824   161 HSWTVPSLGLKTDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEMGPVFTL 227
5835838   161 HSWTVPSLGLKTDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEMGPVFTL 227
5835150   161 HSWAVPTLGLKTDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEMGPVFAL 227
195952358 161 HSWAVPTLGLKTDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEMGPVFAL 227
251831110 161 HSWAVPTLGLKTDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEMGPVFTL 227
295065484 161 HSWTVPSLGLKTDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEMGPVFTL 227
295065514 161 HSWTVPSLGLKTDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEMGPVFTL 227
295065542 161 HSWTVPSLGLKTDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEMGPVFTL 227
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap