Conserved Protein Domain Family
ND5

?
MTH00095: ND5 
NADH dehydrogenase subunit 5; Provisional
Statistics
?
PSSM-Id: 177158
View PSSM: MTH00095
Aligned: 42 rows
Threshold Bit Score: 262.931
Threshold Setting Gi: 99878746
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
23395817    1 MLLFVWYILIFYFFL-IFLILLLPYGKWIYVCGFSDFFS----FVFTYNFEICLFFFVLLLVSFMVFVYGSFYMQGASRL 75 
40548812    1 MLLFVWYILFFYFFL-FSVIFFLPYGKWVFNMGFNDFFS----FILVFNFEICLLIFVLLLVSFMVFIYGSFYMLGVSRL 75 
119637797   1 MLSLNFNTLNLYFFSvPLFYMKMKILKVS------QFLN----LEISLSLLNVIFMISLMFIFKNILKFSIIYMSKTLSF 70 
119655314   1 -------------ML-NLQFIMLPFMNTKVKLCKISYFFn---FEFSLMLMNLLFCVCLLSIFSNILKFSSIYMMGSKYN 63 
119360187   1 ----------MFMCF-PLITLKLKIAKIN------QFLN----MEINISLFSLIFMISLMLIFKNILMFSNIYMMKNLSF 59 
124286777   1 -------------------MCLLPVIQLNLFYSFINFSQ----WSMLFNSLSIIFLLCLWNIFFNVFQFSKNYMKDFSA- 56 
162424486   1 --------------M-NFLLMVIPFTNMNLM---WSFINknsyLSVYFCVLNLIFLISLWNIFYNVLQFSKNYM--KILN 60 
99878746    1 MITTNAIIKNKYFNF----SFFVPYININKEIIKLEFFFn--dLSILNNWQSLIFCVSLNLIFLMIWKFSLFYMSSS-SF 73 
258649591   1 MYFLFYFIFFIYYGL-IFFYFDLGY----------YLFI----LILDLNYYKLFFLLILLVIFYLIIFFGNFYMNYYIYY 65 
299829004   1 MLFFVWYILIFYFFL-FLVVLFLPFGKWFYSFGYNDFFS----FFFTFNSEICLFFLVLLCVSFMIFVYGSFYMVGVSRL 75 
23395817   76 FYFFFFLFLFVLSMGgLIVFSGSIILVLIFWDFLGVSSFFLVLFYNNVVSRSSSMSTVFTNRIGDFCIFLFFNGFIFFSV 155
40548812   76 FYFFFILFLFVFSMCgLIVFSGSVVLTLIFWDFLGVSSFFLVLFYGNVGSRNGAMSTVFTNRIGDFCIFFFFNGFVLFSL 155
119637797  71 YYFKILMWLFCLSMM-ALLFSENFLTLILSWEFLGITSYFLILYYYNWNSMSGSKLTFISNRIGDIFIMTMF-------- 141
119655314  64 SYFKILMWMFCASMI-ILLLSDNFFLLILGWEFLGITSYYLILFYYNWNSLSGGNLTFISNRIGDCFIMPVFFLFIYMNS 142
119360187  60 NYFKILMWLFCLSMI-MLLVSENFLTLILSWEFLGITSYMLILFYYNWNSLSGSKLTFISNRIGDTFIMIMLFLFIKIEH 138
124286777  57 -YFNSMLVMFMFSMI-TLIISDSWLMLFMGWEFLGVTSFFLILYYNNWNSLSGALLTMMTNRLGDMFFIL--------SM 126
162424486  61 TYFNFMMFMFLLSMI-TLIVCNSWLTLFFGWELLGLTSFFLILYYNNWNSMSGSFLTVMSNRLGDMFFIL--------SL 131
99878746   74 KMFVMMLSLFYWSMV-LLIVSSSLFSLFLAWEGLGITSYLLILFYYNWNSIQSSNLTFISNRFGDSFMLIML-------- 144
258649591  66 YYYFFLMLIFLLSMF-FLLLSSSFLFLIFTWDMLGLSSFFLVLFYGNSDSISGSLVTVLTNRIGDYFLLMFI---FLSGL 141
299829004  76 FYFFFFLFLFVLSMCgLIVFSGNVIMTLVFWDFLGVSSFFLVLFYGNVCSRSGSMFSVFTNRIGDFCIFLFFNGFVLFSV 155
23395817  156 GVFSYQFFSSLLVFMLF-ISAFVKGGQYPFGSWLPKAMAAPTPVSCLVHSSTLVTAGVMLMDCYFYVCLNSDVLTFVFYV 234
40548812  156 GHFSYQFFSSLMIFMLF-LSSFIKGGQYPFGSWLPKAMAAPTPVSCLVHSSTLVTAGVMLMDCYVYVSMSADVLSFVFYV 234
119637797 142 FLFSDIKMYAYLIVMIL-IMGVTKSSQFPFNSWLPAAMAAPTPVSALVHSSTLVTSGFYLFFKFKMPMYNMIYKKIMLYM 220
119655314 143 YFW--------LTLMIL-MLGMTKSAQLPFSVWLPAAMAAPTPVSALVHSSTLVTSGLYIFFKFKLPLMSMNLKKMMIFL 213
119360187 139 YYF---------ILMIL-ILGITKSSQFPFNSWLPAAMAAPTPVSALVHSSTLVTSGLYIFMKFKMPLFNIFFKKSMLLL 208
124286777 127 LFFLSLFKSFMMLIIIM-MMSLTKSAQVPFSGWLPAAMAAPTPVSSLVHSSTLVTAGIYVYFRFN-IFMNYTFNKLMMLF 204
162424486 132 YFFMSFKYSTSMMIMLS-MMCFTKSAQFPFSTWLPAAMAAPTPVSSLVHSSTLVTAGIYLYYRFNLMLFNLNKIFVMLF- 209
99878746  145 -FLSESFLLLLVIFVML----LTKSAQVPFSSWLPAAMAAPTPVSALVHSSTLVTAGIILSMKY-KLYEVMNVSKLMFLL 218
258649591 142 FLNKFMLFMNYMFFFLLeLISITKSAQFPFMGWLPKAMSAPTPVSSLVHSSTLVTAGCFLLMHYNYFI-NFNFYFLIIIL 220
299829004 156 GSFSYQFFGSLLVFMLF-VSAFIKGGQYPFGSWLPKAMAAPTPVSCLVHSSTLVTAGVMLMDCYSYLFYDSVVLSFVFYV 234
23395817  235 GFFTMVFSGLCALVEQDAKKVVALSTMSQIGFCFLAIGSGLHYISFIHMISHSFFKSLLFMQIGYLIYINCGNQDYRGYS 314
40548812  235 GFFTMLVSGVCSLFESDVKKVIALSTMSQIGFCFLAIGSGLHYLSYVHMISHSLFKSLLFMQVGYVIYINLGQQDYRGYS 314
119637797 221 GILTMMIGSLSALLSKDIKKIIAFSTLSQLGLLMSSFYSLWLGLMMFHLLSHAFLKSFFFIMFGFSILNMYSQNLNKITS 300
119655314 214 GLLTLMMGSYAAFKSKDVKKIIAFSTLSQLGFLMISFSSLWLGLMMFHLLVHAFLKSFFFILFGLCILTAYSQ----NLN 289
119360187 209 GLITMVLGSYSALLSKDIKKIIAFSTLSQLGFLMISFSSLWAGLMMFHLLSHAFLKSFFFILFGFSIMMMFSQ----NFF 284
124286777 205 FLLTMLLGSLSALMEEDLKKLIAFSTLSQLGLIFLSFYSSFVGLMFFHLFVHAFFKSILFIVGGMMIWSMNSSQLLSNCS 284
162424486 210 -LITTFIGSLSALIETDLKKLVAFSTLSQLGLIFMSFFSSIHGLMFYHLLVHAFFKSILFIISGLMIWSMNSNQNLNKAS 288
99878746  219 GLLTAITGSASALNSMDIKKMVAFSTLSQLGFMVMSFYSSMVTFVLGHLLIHAFLKSLLFLMVGLNMMAMSSQQ------ 292
258649591 221 SLFTIIFSSIMSFFELDFKKIIALSTLSQIGLCFFSFCLGFYFICLLHLLSHAIFKSVLFMQTGYLIYYSFSQQDLRLYN 300
299829004 235 GFFTMVFSGLCSLVEQDAKKIVALSTMSQIGFCFLSIGCGLHYVSYIHMISHSFFKSLLFVQMGYLNFINFGQQDYRGYS 314
23395817  315 YLGiCAPILVQLQ---VFVSVVC-LCGLLFTSGCCSKEYFMSRFYYSSFNFFLVFFYFFGVFLTFCYCYRMMYLF--RVG 388
40548812  315 FYNlCCPVLVQLQ---VFLSVVC-LCGLLFTSGGCSKEYFMSRFYYDSFSFFLVFFYFLGVFLTFCYCYRMLFLF--RVG 388
119637797 301 FYK----MFFKMT---MFYVMFLnFTSFFFTCMFVSKEILVSTIMM--KKIFLFLIYFFILIFTLLYMKRLYFIF--LLK 369
119655314 290 KIDkTLKSLSMMT---MFYIVFLnFTSFFFTSMFISKEFMISNLMF--KKLFFFVVYYIIMILTLFYMKRLYHMF--LTK 362
119360187 285 KITmSFKMFYKMT---MFYIMFLnFSSFFFTCLFFSKEILI--YMSMMNKIFFLIMYLFTLIFTLLYMKRL---Y--FIL 354
124286777 285 ----KLDLSIMTI---LVLSLIN-MMSLMFSSGFLSKESLSLLFMF--KSIKFVIVIIMIFFLTLAYTWRLMNFM--FNN 352
162424486 289 ----IFNVMIFSL---MLVSILN-MMSFTMTSGFLSKEILISMSLSSS--MMFNIIMLVILSFTIIYSYRLITSFkmFLN 358
99878746  293 -LTfSSSMFLKFKygsMYLIIMInFSSFYLTSFYLSKEMNVLAL--TVMNLFLLFLLMTVLMMSLFYAIRFMM----IIS 365
258649591 301 FYD-NMYLYLKVQ---IMVSLFC-LCGLMFYSGMISKHYLLEFFYTINLGFFLLLMVFIMILMTFFYCYKIFFSF--F-N 372
299829004 315 FFSfCAPVLVQLQ---VFLSVVC-LCGLLFTSGYCSKEYFMSRFYYSSFGFFLVLFYFLGIFLTFCYCYRILYLF--RVG 388
23395817  389 CSF---FDYVGFSSKLFYYSCFLLVFFSVVFTFWWISGMMGLVFVFNRFEFLVGFFYLFFIY---CFFNYVFRYVVIEFV 462
40548812  389 ISG---LDYVGFSSKLFYGSCFFLVFFSVVFTFWWIFGLLSFSVAFNRFEFLVVNFYFFFVY---CFLNYFFRYFFLEFK 462
119637797 370 KFY---FSFSFKFTSNFTYMNFKYFFIFNMFSLLWMSNILTYYCYFNYLNLVMLLFLFFILM---NFKFMNIYKYLNMIN 443
119655314 363 EFY---SLKCYKMLNNFSYISIQYFFIFNFFSYIWMQNFLIYYCNSSYLNTLILLFIFFIYLnikLINIFNFLNIFNNFL 439
119360187 355 LSK---KFCLLFSYKFFSNLLMLNIKYILIFNFFSLLWIMNMSKYYFFSNCFSLLMIMFLFF---FFLNLNFMNLY---- 424
124286777 353 FTKtksIINFNTFSVELKYMVFMIFFGKMWTNNWF---------------YSLSWSFIFKMM---LIIMLIMLILFKYIY 414
162424486 359 FKM---SVNFKMLGIILTYLMFMTLFSYMWFLNW-----------FFSFNFNVLIKSLMAFM---MLSMIFKSLIINVFN 421
99878746  366 FKSnkmIKMLGYSDLGVAKIIVMTTIFMFTSLYYKNSSLLMIKPA-IYFKVMTILFLLLVLT---NHKWFCYVTMFSIYK 441
258649591 373 FNY---NFNYLNFSFIYFFLTLMLIFFSLFLIYYLSYNFFFLSVMFLYLDFYLIIFYIVMMM---MVFFLFFNYLYFFLK 446
299829004 389 CSS---FDYVGFSSCLFYFSSFFLVFLSVVFTFWWIFSLLCLPLSFNRFEYLVVFFYIFFIF---CFFNYFFRYSLVELK 462
23395817  463 NKYFMDSYSFFIYKFVPNFFYFDVFILGFNYFFVGLFRLFSFFFFSLFRGFYHVAVLLVFFFMVSFL 529
40548812  463 NKFFMDSYSFIVFKIVPSFFYFDSLAMGFNYFFFGIARFISFFFFSLFRGYYHTGVLIIFFFMLFFL 529
119637797 444 NMFCFILMKAEYIIKEEYF-----------------ILLMKFKMMIFLKNFFNKLPFLVLMLIFLSL 493
119655314 440 AKLMIS-----IIFFVKEEEF---------------MLMMKFNFIIFFKSLTKSVSLFIIMMILLSL 486
119360187 425 --FFLNYMNNLFSNQLLMFKIF--------MKEELFVYLMNFKYVYFLKIYFKKMSLFILFIILLSI 481
124286777 415 SFIFLDLLLINFIFSKMSLLKIEKDS----------FNSFFYFLESYMMKLQNWKMVMLLTLVLVFF 471
162424486 422 NLTMFNFFSSYVCFVNLEKDVMNSSF---------------FFMYAFQTKMMNWKIISLAVLFMTII 473
99878746  442 FNTINNYFSNSMMHMYSDEM----------------FSSLKYFLFKNFMLFNMNKLWLMIIVFLIMM 492
258649591 447 YKYLSDYY----LFLLLGLFYYNFLINNIFFNMFLFFLNFFNFIFNKINNLGYYFLLVFLIIMIMLI 509
299829004 463 GKFFMDHYAVFIYKLFPNFGYVDSFIMSFNYFFWGIFRLFSFFFFSLFRGFYHFGFLIVFFFMLFFL 529
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap