Conserved Protein Domain Family
ND4

?
MTH00094: ND4 
NADH dehydrogenase subunit 4; Provisional
Statistics
?
PSSM-Id: 177157
View PSSM: MTH00094
Aligned: 42 rows
Threshold Bit Score: 203.6
Threshold Setting Gi: 258649597
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
258649597   1 MFILYFFNYYFFSIILLFWLFFVYSNLSYYGLYYLVESNFNYFLIFLMVLIFLYFLLLVLDYLIIIMTYLLLLLSWYFFL 80 
23395807    7 IVLLFFFSPFLFFVFFSIFVLLGFFDYSWCGCFFFFDSFNFVFLSFMSVFILGFICVSEVLGGLVFYSCLIVFFSVCFFF 86 
5835445     8 VVLLFFFSPFLFFVFFMFFVLYGFFDYSWFGCLFFFDSFNFVFLSFMSVFVMGFICVSELLSGLVFYSCLVVFFSVCFFY 87 
40548802    7 VVLSLFFTPFLFFVFFMFFILFGFFDFSWSGLFFFFDSFNFVFLSFMSVFVLGFICVSEILVGLVFYSCLVVFFSVCFFY 86 
124286778   1 --------------------MLILLYLNWNEIFSILMSLGISLVWMIMNVMKYKFKISH------LLLNLMWLIMVLFFM 54 
110082718   1 ---------MLCKILMFSTILIVFNLYSW------FENFAILMILSVSLVWISLNFMKMYFKTSIILMNFMWMLMLIFFM 65 
119360182   1 -----------MFLYLMFFTISLKE---------ISENMIFFFSTFVLITWVMLNKFNNLIYNNMMIMNLILILIILFLN 60 
119637803   1 ----------MYLLLTMMFTMSFKE---------IMEAMTFYFCIFILVMWMILNLTKNMNYNNLFFVNLILMLIMLFMN 61 
119655308   1 ----------MFYLLLIFFIMLFKE---------IMENFICLLNILTIVVWVIFNILKYSNYNNLIIINMILLIILLFFN 61 
99878750    1 ----------MIIMFLLIKTLKVYV---------MFKSWLNLFLLIMMVIWLLLNFLSLMTWSKNLLVNSMMIIIWLFFI 61 
258649597  81 SLNFFLFFIFFELSSFPVIILTLVYGVQIEKFSSVFYLLFYSFFLGYLFFFLLLYNYYYF---NLNFLIYCF-WKMnkfy 156
23395807   87 SGSFLILYIFYELTMLPVLFCLLGYGRQVEKISACYYLVFYTLFFGMPFLFFFSHVFNFF---NFVYYDFFMsFEL---- 159
5835445    88 SGSFLMLYVFYELTMVPILFCLLGYGRQVEKISACYYLIFYTLFFGMPYLFLYSHVFFFL---NFVYYDFFVsYEF---- 160
40548802   87 SGSFLVLYVFYELTMIPMLFCLLGYGRQVEKISACYYLIFYTLFFGMPYLFLYSHVFFFM---NFVYYDFFFsYEF---- 159
124286778  55 TQSVWKFYLLFEMNMIPMVLILMGWGMNMARMTSSIYMMMYTMFFSLPVLIIILNNWKLI---FFSTFDIKNhYMIlf-y 130
110082718  66 TNTIWKFYILFEMNMIPMVLIIMSWGSNMARINSSIYMMLYTFFFSLPVLVIIMNNLKFMgfsSLDLNNHYLnNIF---- 141
119360182  61 SLILWKFYLLYEFIMIPMIIFLMSWGLNPARLSASLYLMVYMCLFSLPCLLVMIMNMKIFf-tNMQHSMFVLnFFS---- 135
119637803  62 SLMLWKFYLLYELVMLPMTILLLSWGVNPARLSANLYLLIYMGMFSLPCLLLIILNLKIFf-mNMQHSMFMMnFFC---- 136
119655308  62 SMMLWKFFLFYEISMLPIIILLLSWGNNPSRLPAALYMIIYMVIFSFPSMVVVIKNLKVF------LVNLNIsITLnlvs 135
99878750   62 SNSVSLLYIIYESIMLLMILLIVGWGLNPYKFNAFMYLMAYSMLFSLPAMMVVLVNYQMLltyNLMAKNLNVsVLS---- 137
258649597 157 IYLFLLVFLMKFPIYYLHFWLPKLHVEASTLASMLLASILLKFGVMGYSRFLGSLLMVNFFLFFLFGLLGLIICVFMCMI 236
23395807  160 VFLLSLCFLVKFPVYFLHAWLPKVHVESPTSTSMVLAGVMLKLGGAGIYRISKSLNFFGFELLVFFSLIGMVFCSFICIF 239
5835445   161 IFLLSLCFLVKFPVYFFHVWLPKVHVEAPTSASMILAGVMLKLGGAGVYRISKSLNFFGFEMLIFFSLISMVFCSFICVV 240
40548802  160 IFLLSLCFLVKFPVYFLHVWLPKVHVEAPTSSSMILAGVMLKLGGAGVYRISKSFNYYNFEFLIFFSLVSMIFCSFICMV 239
124286778 131 KLILIIMFMAKIPIFGLHYWLPKAHVEASTMGSMILAGGLLKMGSFGFFKVFVWTSILMNSSWV---LLGTLISSFYCFV 207
110082718 142 NFMLILMFMVKIPVFGLHYWLPKAHVEASTMGSMILASGLLKTGSFGFFKTLLWNSAILNYSWM---LIGFVFSSLYCCM 218
119360182 136 KFMMVLMFLVKIPLFSLHYWLPKAHTEASTMGSIILASGLLKMGGAGFWKMILFLEFTLMNYSIIFYLV--LFSSMVCLF 213
119637803 137 KFIMILMFLVKIPLFSLHYWLPKAHTEASTSGSIILASGLLKMGGMGLWKMLNFMQFNLMNYYIILSL--SLLSCLVSTF 214
119655308 136 KLILIFMFLVKIPLFTLHYWLPKAHTEASTFGSMVLASGLLKMGGIGLWKIMKFLQFKFLNYFFLMTL--TLISSLICLM 213
99878750  138 FIMLMMMFLVKMPVFFLHYWLPKAHVEASTTGSIILASGLLKLGSVGVFKIMNWGNFIKLSNYSFF-VVGTFVMSLCCLF 216
258649597 237 QSDSKSLVAYSSIVHMSFVLCMFMMLSLFVKMSSLMMVLSHGYVSLLMFFFVGEIYHNLFSRLVYFFFGLFFFNYFFFLL 316
23395807  240 QSDCKSLAAYSSICHMGFVLLSEISMLYYGKSMALIMMLSHGYTSVLMFYFIGEFYHIASSRLVYYLRGYFSINLLFCLI 319
5835445   241 QSDCKSLAAYSSVCHMGFVLLSEISMVYYGKSMALVMMLAHGYTSVLMFYFIGEFYHIANSRLIYYLRGYFNVSMLFCLM 320
40548802  240 QSDCKSLAAYSSICHMGFVLLSELSMVYYGKSMALVMMLSHGYTSVLMFYFIGEFYHIANSRLVYYLRGFFCVSMLFCLM 319
124286778 208 QSDQKKLIALSSVSHMGLATSAFMMMSNVGTTGMILLNFTHSVISSFMFFNAGSLSSHSKSRLLSFIPKM---SKHLMMM 284
110082718 219 QSDQKKLIALSSVSHMSLACCSLLSFSNIGMFGMIILNFTHSIISSFLFLNSGIFSSFSKMRLFKYLP---KTSFHNIIL 295
119360182 214 QTDFKKMIALISVFHMSLSISIINVMSLNSYLSFIYLNMAHILSSSILFYFSGFLYSINKTRLIFMMMMNNNSKIFIFLI 293
119637803 215 QTDFKKLIALISVFHMSLSVSILFTANFHSYLSFMYLNMTHILSSGILFYYSGFLYSLNKTRLIFLLPMNLNSKIFFLLI 294
119655308 214 QTDMKKLVALMSVFHMTLSVTTLSILMYTSFLGFVYINLTHIMSSSILFYFSGYSYSLNKTRLLFMMKITINSKLF--IF 291
99878750  217 QTDFKKLIALTSVVHMNMSLTSIFYSSVSGLKSFTMINVIHSISSFMLFYLAGMLMVFSKTRLVY-LQMMLKFSLLFYLF 295
258649597 317 FSIIFLMNVGLPLTLGFFSEFLGFMIMIMYMDMMIIFVFILFIFGFYYSLYILLSLYLGKKYLFFYKIYI-LNLLVILFL 395
23395807  320 FCLTMISNFGFPSSISFFSEYLMLNWFSSVFYFSVFFLFIYYLVSFYYSIYVMVCFMVGNKVSYVCDSRA-VVCLPLIFM 398
5835445   321 FCLTMVSNFSFPVSVSFFSEYLMLNFFSSVFYVGFLFLFFYYLVSFYYSVYILVCFLVGGKVSYVCDGRS-VVCLPLVFM 399
40548802  320 FSLTMLSNFGFPSSITFFSEYLMFNWFSSIFYISVLFFFFYYLLSFYYSIYVLICFFVGNKFSYVFDGRG-IVCLPVMFM 398
124286778 285 FALGIVVNLGLPPSFSFMSELFSISGIFFMNFNTMLLIFFIMILTLSFSCMYIMGLYQTNFMSNNNMSLS-MVFLQILHF 363
110082718 296 LVVSIILNLGLPPALSFISEITCMAGVFMNNLLSAIMIFIAMILSLFFSYIYIFFSNQSFISNCFYINNK-LLFMFLIHF 374
119360182 294 ISILM--NLGIPPFFTFFVEILSLSIMFLKNFFMFIFILFIFIFSAIFNLFII---------NMMKSLKMkSLKMNFFLP 362
119637803 295 --IIILMNLGIPPFFTFFVEILNLSVFFYKNFNNFIMIMLILVIVAVFNLFILNS--MKMMMLKTLKFSF-FISFYFIFM 369
119655308 292 LSLMLLLNMGIPPFFTFFVEIINLSQLFYKNYWSLMLTIFILIAVALINLFFM--SMMNMLITKSMKFMF-FINFYYIFM 368
99878750  296 MCAIFM-NLSVPPFFSFMGELIYYSLVSVSNYIYLCLNLMILVISLMFSLLLVNNMSMKKIVKPMLSSLM-CLVLPSVMG 373
258649597 396 NFNFIFFILSF 406
23395807  399 VYNFFWFIFVI 409
5835445   400 MYNFFWFIFVI 410
40548802  399 MYNFFWFIFVI 409
124286778 364 SFMMFWVFYQM 374
110082718 375 TLMMFWFSIF- 384
119360182 363 FYYFFFFSLMM 373
119637803 370 VSLSMWHMI-- 378
119655308 369 MMFLMWLMV-- 377
99878750  374 V--MLWLN--- 379
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap