Conserved Protein Domain Family
ND4L

?
MTH00093: ND4L 
NADH dehydrogenase subunit 4L; Provisional
Statistics
?
PSSM-Id: 177156
View PSSM: MTH00093
Aligned: 35 rows
Threshold Bit Score: 40.9966
Threshold Setting Gi: 119637794
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
110082715  7 SLMLFMLMIMVLSHYYMIIFMMIVLELLNLIFLLMILKYMNLEIVLLSLMIQVLDSLIIMVFMIISLFSWEKSNnwsNLL 86 
5835450    1 MFLFFFSFLFLFFKYERLVFILLGIEFLFFSLLVYYVFLFESVMFFYFLCFGLMSGVLGLVIFFFCVKGFGVDK---VMF 77 
91176187   1 MIFMFISSLSLFFKWQRLIFILISLEFIVMSLFIYFSTVLNEMMFFYFMCFSVISSVLGMIVMVGNMKFYGSDQ---CLF 77 
40548807   1 MFLFVLTFLFFVFKYDRLIFVLIGIEFFFFSLLVYYVYFFESVLFFYFMCFGVISGVVGLVIFFFCVKGYGFDK---VMF 77 
49146520   1 -MFLFFSILSFLFKWRRLLFVLISLEFLMMSLFIIYSYMLNEMMFFYFMCFSVISSVLGMLMMIGSVKFYGSDN---CLF 76 
119360178  8 FFMLIFCMILLILNYKMLVFFLIIIELISLTLIIYLMYFINFYFIFLTLFVQVFESVILILLTFDNFSNSNMIE---NLM 84 
23395812   1 MFLFFFCFLYFVFKYNYLIFVLLGIELLFFSLLVYYIFFFNSIVFFYFLCFGLMSGVVGLVIFFFSVKSFGVDK---VMF 77 
189095457  1 MIFMFISFLSLFFKWQRLMFILISLEFIVMSLFIYFASTLNEMMFFYFMCFSVVSSVLGLVLVVGNMKFYGSDQ---CLF 77 
124286779  4 VKLIFIPIFMMFYS-KMMIYFLIILELMNIMILMIIMMLYNLEAVLLVLLIQVLDSIIIMSYTMMNLLSWESSFn-wSLI 81 
299828999  1 -MLFFISVLFFLFKYDRLIFVLLGIEFLFFSLLVYYNFFVESLLFFYFMCFGVFSGVVGLVVFFFSVKGYGYDK---VMF 76 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap