Conserved Protein Domain Family
ND3

?
MTH00092: ND3 
NADH dehydrogenase subunit 3; Provisional
Statistics
?
PSSM-Id: 177155
View PSSM: MTH00092
Aligned: 42 rows
Threshold Bit Score: 45.6554
Threshold Setting Gi: 99878582
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
40548811    2 FLDFFVVFLFSFFVSLLMYFFSMFVSYKDFFESKVSSYECGFDVCKKVHVGFNLVFFSIVLLFVVFELEVIIFVFLVQGD 81 
124286783   9 CLMLVKLLVYIFILIMIVVLLNFLICENNQLYTELKPFECGFEPMYWSHSKLSIHFFKIGIIFILFDLELLLLLFTMVK- 87 
119655306  10 SFIQIFIFIFMILILMNFLLNEYFTMTKS----QLLNFECGFDSVKWYFSNISNHFFKIGIVFVIFDLELMYMMFVIFNE 85 
119360183  12 MTVMILLMVIILIMFMNLIFKEFYFLNKN----QFFLFECGFESISWYFNNISNHFFKIGIIFITFDLELMYFLFFIFNL 87 
110082719   1 ---MVNIIVNLLIMITIIFMIHFLIFDYSKFFMEYKPFECGFENMYWLHQKLNIHFFKIGIVFILFDLELLLLVLSFSK- 76 
119360184  12 MTVMILLMVIILIMFMNLIFKEFYFLNKN----QFFLFECGFESISWYFNNISNHFFKIGIIFITFDLELMYFLFFIFNL 87 
5835454     2 FLNFIVIFFFSFLVPFGMYLLSFFVSFKDFYGAKLSSYECGFDVVKKVHVGFNLVFFSIVLLFVVFELEVLIFIILIQGD 81 
119655307  10 SFIQIFIFIFMILILMNFLLNEYFTMTKS----QLLNFECGFDSVKWYFSNISNHFFKIGIVFVIFDLELMYMMFVIFNE 85 
119360189  12 MTVMILLMVIILIMFMNLIFKEFYFLNKN----QFFLFECGFESISWYFNNISNHFFKIGIIFITFDLELMYFLFFIFNL 87 
99878582    1 ----MVKILSFLLILVLLIMLNFMLSLFKSNVNSLKIFECGFEIFYWSKPKTSIHFFKVGLIFILFDLEFLFLLLLFKE- 75 
40548811   82 LFSVFSFFMFFFYVVLSFYMEWSFGKLIWIC 112
124286783  88 --FLILTWCIMIFIFFSIWVEYFIKGFNWTV 116
119655306  86 V-SMKLILVILIFILATLFIELFFMSLTWNS 115
119360183  88 I-NMKMIWLIFNFIFFTLFLEFFLNTLSWNM 117
110082719  77 --FMMLIWIIMIFIFFSLWIEFKSFSINWTM 105
119360184  88 I-NMKMIWLIFNFIFFTLFLEFFLNTLSWNM 117
5835454    82 FYSLLSFFVFFFYVVFSFYMEWCFGKLIWFC 112
119655307  86 V-SMKLILVILIFILATLFIELFFMSLTWNS 115
119360189  88 I-NMKMIWLIFNFIFFTLFLEFFLNTLSWNM 117
99878582   76 --TKIYTLMVLSFIYFTIWLELVMKSYLWSN 104
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap