Conserved Protein Domain Family
ND2

?
MTH00091: ND2 
NADH dehydrogenase subunit 2; Provisional
Statistics
?
PSSM-Id: 177154
View PSSM: MTH00091
Aligned: 41 rows
Threshold Bit Score: 122.286
Threshold Setting Gi: 119360180
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
119360180   1 MMYMIMLLISMNLFSWWWFWMMLEILNWFL--ITWM--KKKVIKLLFLLWQSLSSLLLLFYL-LInlnffFYFFFFFMKM 75 
23395806   10 LFLSFINFCVLDYIVWWSVFVICTFVFVFL--TIGGg-STSCLVNYYVIQEVCGYYFLVFDS-WK-----FQFFFLMLKS 80 
110082713   4 LIYFLIMIFSLNIYLWWWTWLMVELLNWFL--MLMM--KSNYILL-FLMWQSFSSVMIMFSV-FYmn--nMILLFILLKM 75 
5835444    11 LFLSFINFCVVDYIVWWSIFVICTFVFVFL--VGGElgFSSCLVNYYVIQEVCGYYFLVFDG-WK-----LQFLLLMLKS 82 
124286780  10 ILYLMLIMMSLNLSSWWWLWLSFELLNWLL--MLIM---NSNYLMVFLLWQSLSSLSIVYSL-IFin--kFMFIFLLMKM 81 
119637796   1 MVYLLLNFISLNLFSWWWFWIMLEILNWFL--ITFM--NKKIIMLNFLLWQSLSSLMILFNL-VAnldyfFINIFIFMKT 75 
119655305   1 MIYMLALICSLNLFSWWWFWLVLEFLNWVL--MLMM--KKKNIMLIFLLWQSLASLMILFFL-MInlnffLIVMFTFMKS 75 
40548801   11 VFLSCVNFCDVDYIIWWSVFVVCTFVFIFFvcNNSLd-NLGCMVNYYVVQEICGYYFLLFDS-WK-----LQFLFLMLKS 83 
207266407   9 MLMFFMSFMVVNYIVWWGLFLVMDLFFVFL--CKLEgcSYSSVINYFIFQEFLGLVFLIVSGwGV-----IQGVVVMCKM 81 
99878749    2 QFYILFMLVSLNINSWWWVWLMLEVLNWTF--IYFL--KNMNLLIVFFMWQSISSIIFLYSF-LFfkkklLIFISLLMKT 76 
119360180  76 SLPPFQQMFWKLHIYLNWKIFIIFMTLHKFLPMMFMTMFFMKNFMNIIIFFPLIIFYMFWNKMNLISNLFMFLMSDSFWM 155
23395806   81 GSAPFHFWLFSVLSNLKGWSILWFLTLQKLPYFVVLLNFCSDFFFLFLFFGMIFCYVHFFLLRNFLDMVVIGSTESFNWL 160
110082713  76 GMPPFHHLIINSQFNWSFISFIVFNTIHKYLPCLILMNFMYMNLMFLMLIFLGILF--FLFNFSLKLFILGMSIVDMFWM 153
5835444    83 GSSPFHFWLFSVLGGLNKWFVLWFLTLQKLPYFVVLVNFCGDFFFLFLFFGMIFCYFQFFLLRSYRDLLVVGSAESFNWL 162
124286780  82 GLPPFHYWVIYSQKMWSFLSFIMFISVHKYLPTIILINMISWMNWSVLLLPIGLLF--FWSNNYMKFFIFGISIMDMFWM 159
119637796  76 SLPPFHYLFWKFHIFVSWKVFMIFMTLHKFLPLMFMVMFFMKIFYITIIIFPVITFFMMWNNMNLFSNLYLFMMGDSCWM 155
119655305  76 SFPPFHYLFWNLHFFTNWKVLVIFLTIHKFLPLLFMTMFIMKIFLLFIVFFPILLFSLFWNNLNLPSNLFMFMLSDSCWM 155
40548801   84 GSSPFHFWVFSVLGGLKKWFVLWFLTLQKLPYFVVLINFCSDFFFFFLFFGMVVCYLQFFLLRNYSDVVIIGSVESFNWL 163
207266407  82 GLLPFHYWLLTVIDGLSGWVLFWFLTGQKLPYMGILVVLASYIFVVLVFLGFVMVYLQFFVIKDYFMILVLSSTESFNWF 161
99878749   77 SLPPFHLWMWMLLSVMDWKSMVLLMCVHKYTPILIMMNNFSYLNCFYFIIFSLISFFNMWMASSLKKIFWVILLNDTVWL 156
119360180 156 IIAFFLSL-KMAIVYMLVTTMMFIIFWSYKNQNKENIsNKMNLkfiLLLMFSLPPFFTFLIKFNLVF------SMM--FH 226
23395806  161 LLLGMFSFnEVFVLFFFYYFVMFLII-SYIYNSGINF-ISLEM---LMIFFNVPLSLTFFLKVLLLF------GTSsmVG 229
110082713 154 ISSWLISM-KIFTIYLLMNLFILLMWLNSWKTSNINF-YSFNIqiiLIFLCSIPPLSSFVMKWLIVGflnfnmGLVslMG 231
5835444   163 LLLGIFSFnEVFVLFFFYYFVMFFVI-SYVYGGFLGF-LSLEM---LMFFFNVPLSITFFLKVIVLF------GSSffVG 231
124286780 160 IMSWEFSL-KLLMVYLVINFLMMLMLWTINSSN-INL-KSYDMqliLVFLLNMPPFLTFMIKWMIIG------MMTlmLS 230
119637796 156 IMSFFVSL-KMSIFYMLMNLFMFFMMMMIKPINKENFkNSVMMkfiLLLLFSLPPFFTFLLKFLLIS------SISthVV 228
119655305 156 LFSFMVSL-KLMVVYMMLNLMIFFYLYLINIKNTKFI-NNILTkicILLITSLPPFFSFLLKFIIVY------SVNfeLM 227
40548801  164 LLLGIFSFnEGFVFFFFYYVTMFFVI-SYVYSGFLSF-FSLEM---LMVFFNVPLSITFFLKVLLLF------GSGffVG 232
207266407 162 FLGVLMNLfSGLVLFLFYFLSGLLLLPFWSGVSKVNY--GWLT---TLIYINIPLGVSFLVKMFVLG------LAVnyLF 230
99878749  157 MLS-FYCMlNMMFIYMMFNFIIMFIFMNWK----LKFsGYLMM---LLFVTSLPPLPTFQLKWLILSsl--siNMMvvLI 226
119360180 227 FMGFFLMMYLISIFFYWEIFYLTVINLLMFNLKLNMFMYLFILIHLMFLFLL 278
23395806  230 FFYFFLLLFMCLMSLGVSYLFFCVSMIGFNFGLKYYDYFFYLLFCIGLLSVF 281
110082713 232 SWFIMILMWMWLSLQLINKELIFES-----------KDINMMMIMLMMLWLL 272
5835444   232 FYYLFLLLFMPLMSLGVGYLFFLVSMMSFNCGFKYYDYFVYVLFCIGLLSCF 283
124286780 231 IISLFLSLLPILMV----WFWLSLNLIQNSMMMNKVNKNMMYMVLLTILWIF 278
119637796 229 LLFLFLYLISIFFYWEIFYFTI---INLLLMSFKSNMLYILIICHMMFLWIL 277
119655305 228 IMFMSVYFISFFFFESFSFLELQ-------------------MLIYSKLKWI 260
40548801  233 FYYYFLLLIMPLMSLSIGYLFFLISMSGFNQGLKYYDFFVWILLCIGFLSYF 284
207266407 231 LFLLFVMVLMYMSFMSIFSWFMLMSFEVVLEEVKVDGFIFMVFALIFLLLIY 282
99878749  227 VNLLMLLFFMILLFMTLKMHKMFKDSLLSLYYMSFSMGFWFFFM-------- 270
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap