Conserved Protein Domain Family
ND1

?
MTH00090: ND1 
NADH dehydrogenase subunit 1; Provisional
Statistics
?
PSSM-Id: 177153
View PSSM: MTH00090
Aligned: 39 rows
Threshold Bit Score: 239.415
Threshold Setting Gi: 119655313
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
288903199   1 MVVLVLVFVLQSIAFITLyerhllggviywvwasfigYERHLLGSSQIRLGPNKVSFMGLLQALLDGLKLLKKEQILPIY 80 
40548808    8 GFLIMIVFILQSVAFLTL-------------------LERHFLGGSQCRIGPNKVAYCGFFQAFFDGLKLLKKEQLVFFC 68 
5835451     8 GLLVMIVFILQAIAFLVL-------------------LERHFLGGSQCRVGPNKVGYCGVLQALFDGLKLLKKEQLLLCF 68 
99878751    2 QMIISIILIMISIGFFTL-------------------LERKLLSLSQIRLGPNKTLIIGMIQPILDGLKLIKKGIIFNKK 62 
23395813    8 GIFLMIIFILQAIAFLTL-------------------MERHFLGGTQCRIGPNKVGYSGIFQALFDGLKLLKKEQLFFYF 68 
119360190   4 NNFIKLIFMLLAIAYFTL-------------------MERKVLSLSQMRLGPNKTSMIGILQPILDGIKLLKKFLILPLN 64 
119637799   4 CLLIKFIFIMLAIAYFTL-------------------LERKILSLSQMRLGPNKVLMLGLIQPILDGLKLMKKLLIMSLN 64 
119655313   4 IFLLKLICILLSIAYFTL-------------------SERKILSLSQLRLGPNKTSLLGVIQPVLDGLKLLKKVLVTPMN 64 
207266405   4 LVLILMLLLVQGVAFITL-------------------CERHLLGGSQQRVGPNKVSFMGVLQAIFDGVKLIKKEQLLSVH 64 
299829000   8 GLLVMMVFVLQAVAFFTL-------------------LERHFLGGSQCRIGPNKVGYAGVLQALFDGLKLIKKEQLLYYF 68 
288903199  81 SSELIFLLVPGVSFLVMILEWFLLPFFFDFLSFEYSLLFFLCLLGFVVYSLMISGFISKSKYGMIGALRASSQSVSYEII 160
40548808   69 SSWISFLFVPVCGFVLMIFFWFTLPYFFSFLTFEYSGVFLFCLMGVSVYFIMLSGIFSGGKYSFLGGIRSCAQSYSYEIA 148
5835451    69 SSWLSFLFMPICGFVLMVFFWFTLPYFFSFLSFEYSGVFLFCLMGVSVYFIMLSGVFSGSKYSLIGGLRACVQSYSYEIA 148
99878751   63 IYIIMFNMGAFFLLMLAIFLWMSFPFLM-WINKSMVMFWILLLLGLSTYMLFLIGWSSLSKFSFLGSMRALAQTISLEVL 141
23395813   69 SSWLSFLLMPVCSFILMIFFWFTLPYFFVFMSFDYSGVFLFCLMGVSAYFIMLSGIFSGGKYSFIGGLRACAQSYSYEIA 148
119360190  65 SMVLFLMITSILMLIISLFLWFIYPF-FSFINKNHFFLWILLIFGMLSYFILMIGWTSLNKFSYLGGARGVSQSLSFEIL 143
119637799  65 SMVLFLMMNSMWMFSISMLLWFMFPF-FALMNKSSFFLWILLLFGFLSYFILMIGWSSMNKFSYLGGTRSLSQSLSFEIL 143
119655313  65 MMYFFLVMNSIMMFSISLLLWFLFPFFSNINKNSF-LLWLLLLFGFLSYFILLIGWSSVSKFSYLGGVRGLSQSLSFEVL 143
207266405  65 SSGFSFVFIPGITFLVMYMEWFVMFYLYDFFSFGYSVLMFMCLMGFSVYSFLLSGIVSKSKYGLLGALRASNQSVSYEIA 144
299829000  69 SSYVSFLFVPVCGFVVMFFFWFTLPYFFCFFTFD-SGIFLLCLMGFSVYPVMLSGIFSGGKYSFLGGMRSCCQSYSYEIV 147
288903199 161 FSIFLL---SVMMYLGVFVFVKGFLILMIFMWLPFLIMIVAELNRAPFDFSEGESELVSGYNVEFGSVSFVLLFLSEYGS 237
40548808  149 FSVYLL---VFFLFNKSLCLFFSFSFFFFCFLFPFSCLVLVDLHRAPFDFSECESELVSGYNVDYSSMGFAFLFLGEYGN 225
5835451   149 FSIYLL---VFLLFNKGLCLSFSFCLFFFLFFFPFFCLVLVDLHRAPFDLSECESELVSGFNVEYSGVGFAALFLGEYGN 225
99878751  142 FSMLMFlgfSLMSKYNTTYYNQSNNLVQVTLTFYFFITILIEAHRAPMDLSESESELVSGYNTEFSSVTFVMIFLSEYSN 221
23395813  149 FSVYLL---IFLLFNKSLCLSFSFCLFFFFIFLPFFCLVLIDLHRAPFDLSECESELVSGFNVEYSSVGFASLFLGEYGN 225
119360190 144 ILLLIVt-pFMITNKASLTLINQFSVINVNLMFIFFFLSILECQRSPMDLSEGESELVSGYNIELSSVMFIFIFLSEYNT 222
119637799 144 ILLIMTp-pFMISKCSLLTLSNKFSLINFTMILVFFILSILECQRSPMDLSEGESELVSGYNVELSSITFIFVFLGEYNT 222
119655313 144 VLLIVSy--PFLLKNTSLLCVNYYSLLNNVYILLFFIISILECQRAPMDLSEGESELVSGYNIEMSSLMFIFIFLSEYNS 221
207266405 145 FSLFLL---SVIVFMGGYCFVPVGLGWFFFLVGCVFFVILGELNRAPFDFSEGESELVSGYNVEYGSVSYALLYIGEYGS 221
299829000 148 FSIYLV---VFFFFNKSFVLSGSFVFLFFLFFLPFFCLVLIDLHRVPFDFSESESELVSGYNLEYSSVGFAFLFLGEYGN 224
288903199 238 LIFFCLLLSVFFFDFSLLMVFLIFSLLIFLRSSYPRYRYDLLMSMFWFK-FLPISLVYFFFFIFWLY 303
40548808  226 LLYFNCLVSSLFFDMSFFFFYFFVCFIIFSRSSYPRFRFDMLMSLCWFV-FLPFGFYFFGLSFVVFL 291
5835451   226 LLYFGCLTSSLFFGMSFFFFYFIVCMIVFSRSAYPRFRFDKLMGVCWFL-FLPIGFYFFGLSFVVFM 291
99878751  222 MIMFMGLAMFLWLKQLILYWLVLLTCILMVRSCYPRIRYDHLMNLCWKNmFFSLIMLMILFYPMKFI 288
23395813  226 LLYFSCLTSSLFFGMSFFFFYVVVCLIIFCRSAYPRFRFDVLMYICWFL-FLPIGFYFFGFSFVVFM 291
119360190 223 MIFMMSIMWFIYLKMMSLLLCLSLFLMLLIRSCFPRIRYDHLMFTFWLK-VLPLIILILMIMVNFKQ 288
119637799 223 MIFMMMVMWFIYYTMSLFFLFISLSLMLLIRSCFPRIRYDFLMSLFWFK-ILPLIIIMLMIIMSFKM 288
119655313 222 MIFLMSIMWLIFMKINIFLLLISLMLVLLIRSCFPRLRYDYLMTLFWLK-ILPLLIISYNILMNLKN 287
207266405 222 MLFFSLLISLMFFNYSFFIFYLVFVVLIFVRSSYPRFRYDMMMGFFWFV-MLPLSLFLVFFFVVLLV 287
299829000 225 LLYFSYLTSCFFFDMSFFFFYLVVCAIVFSRSAYPRFRFDMMMSMCWFV-ILPFVLYFFGLVFVVLM 290
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap