Conserved Protein Domain Family
CYTB

?
MTH00086: CYTB 
cytochrome b; Provisional
Statistics
?
PSSM-Id: 177151
View PSSM: MTH00086
Aligned: 40 rows
Threshold Bit Score: 354.246
Threshold Setting Gi: 99878752
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
99878588    1 MFIKKLVFSLKSPMNLSYWWNLGSLLGLMIVVQILSGFMLTFYY-ENSPYSFNSLWMIHLDMVKGYLLHYIHLNMASYVF 79 
40548805    2 GVFNSLVF-LPASFSLSYMWNFGSMLFVMLVSQIFTGFFLTFYYtSGG--AFASVQYIMFEVNMGWFLRILHSNGASMFF 78 
124286781   1 --MKTLKISLKTPFNLSYWWNLGSLLGIIMVIQIVSGVLLTLYY-ENSEMCFDSIYLIHIETFYGVLIHFIHLNLASLIF 77 
99878752    1 --MKSYKFSLMTPMNLSYWWNIGSLLGVLMMVQIMTGIMLVLYY-DNSDLSFISVMMIHLEINFGYLFHIIHLGFSNYIF 77 
119655312   1 -MNKNFKISLFSPLNLSYWWNLGSLLLMLILIQILSGVMLSLFY-ENSMMSFTSLWVIHMEIFNGSLIHYIHLNFASFLF 78 
119360185   4 LMNKSLKITLFSPMNLNYWWNIGSLLIMLMFIQILSGFLLTLFY-DNSETSFKSLWLIHIEVFFGSMLHYVHLNFSSFIF 82 
5835448     2 AIFNSLVF-LPASFTLSYMWNFGSMLGIMLMSQILTGFFLTFYYtAGE--AFSSVQYIMFEVNLGWLLRIMHSNGASMFF 78 
23395810    4 GFLNSLIF-LPASFSLSYMWNFGSMLGIMLMSQIITGFFLTFYYtAGD--AFSSVQYIMFEVNLGWLVRIMHSNGASMFF 80 
162424487   7 NEYNKLKLKLKAPLNLSYWWNLGSFVSLIMSIQIITGLFLTFYY-ENSENCFDSIYIIHIETFYGVLVHFIHLNVSSIIF 85 
299828997   2 SFFNSVIF-LPASFSLSYMWNFGSMLGIMLFSQILTGFFLTFYYsAGD--AFSSVQYIMFEVNFGWLLRVMHSNGASMFF 78 
99878588   80 MIMYLHIIKGLLYNSFsQLKYLWISGWVLMMIMMMIAFMGYVLPWGQMSLWGATVITNLISAFPIVGISLVEWVWGGYFV 159
40548805   79 LFIYFHIFKGLVYGSY-RLRFVWLSGIFIYFLLKGVAFTGYVLIWGQMSYWAAVVITSLMTSVPYLGKYLVWWIWGSFSV 157
124286781  78 LLMYFHMLKGLIFNSFsSLKWAWVSGWMMMMLLMLSAFMGYVLPWGQMSLWGATVITNLLSAVPYLGKSMVEWIWGGYFV 157
99878752   78 IALYLHMIKGLLNNSFtKFKLLWISGCIMMVMIMMIAFLGYVLPWGQMSLWGATVITNLLSVLP-YGSSLVKWVWGGYFV 156
119655312  79 MVLYFHMVKALLYNSYlNLKFVWLTGWLMMILFMMIAFLGYVLPWGQMSLWGATVITNLLSTLP-FGNYLVQWIWGGYFV 157
119360185  83 LFIYLHLIKGFVYNSYlNLKLVWMLGWLILILLMMISFLGYVLPWGQMSLWGATVITNLLSTLP-WGQQLVQWIWGGYFV 161
5835448    79 LFIYLHIFKGLIYGSY-RLIGVWLSGIFIYFLLMGIAFTGYVLIWGQMSYWAAVVITSLMTSVPYLGKYLVWWIWGSFSV 157
23395810   81 LFIYLHIFKGLINSSY-RLSSVWISGIAMYLVLMGIAFTGYVLIWGQMSYWAAVVITSLMTSVPYLGKYMVWWIWGSFSV 159
162424487  86 FLIYLHMTKGLIFSSFsMMKITWISGWIMMMLSMLSAFMGYVLPWGQMSLWGATVITNLLSAIPVIGKMMVEWIWGGYFV 165
299828997  79 LFVYFHIFKGLIYGSY-RLVLVWVSGVIIYFLLMGVAFTGYVLIWGQMSYWAAVVITSLMTSVPYLGKYLVWWIWGSFSV 157
99878588  160 SNFTMKLFFSLHFLIPFILLIMILMHLFILHLFGSSSPLGGFNMLMKEEFDLIYIWKDAVNILILMIMMILSLFFPYVFG 239
40548805  158 CDNTLKFFYSIHFILPWFLLLLVVVHLFFLHFTGSSSVIYCHGDYDKVHFFPGYWLKDGLDILFYFFFVLFSLYFSFNLS 237
124286781 158 SNFTMKMFFSLHFLVPLLVLVLIMIHILILHYYGSSSPIGSSF-LSKTEFNPMYSWKDLISFTLFVFLIIMMFMSPYKTS 236
99878752  157 SNFTLKIFFCLHFLLPIVLIAIIVMHLIILHYSGSSNPLGLSSSLLKLEFAPAYVYKDLLNIIIIMLLILLTLSSPYLFS 236
119655312 158 SNITLKLFFSLHFLFPLLTLTVIALHMITLHYYGSSNPLGTYNNIVKSEFSLNYLVKDLVNIILLLVFIIFSLLKSFNLS 237
119360185 162 SIITLKLFFSIHFMAPVFLLVMIFFHMIVLHYSGSSNPLGFFNNLIKLEFSLNYLMKDFLNFLMILILFIFSLVYSFKLS 241
5835448   158 CENTLKFFYSVHFILPWSLMVLVVFHLFFLHFTGSSSSLYCHGDYDKIHFFPSFWLKDGFDIFFYFFLILFSLYFSFDLS 237
23395810  160 CENTLKFFYSIHFIFPWLLLVMVIFHLFFLHFTGSSSSLYCHGDYDKIHFFPSYWFKDGFDIFFYFFLVLFSLYFSFNLS 239
162424487 166 SNFTMKMFFSFHFLVPFIILIFIMIHLIILHYYGSNNPIGNFS-LMKIEFNPIYSFKDLMSIIFIILMFVLFFYSPYFMV 244
299828997 158 CENTLKFFYSVHFIFPWVLMVLVVFHLFFLHFTGSSSSLFCHGDYDKIHFFPSFWFKDGLDIFFYFVLFLFALFFSFNLS 237
99878588  240 DPENFIKASPMISPIHIQPEWYFLHYYAILRSIPNKLGAVIFFIMALMMVLSLGLLSAKFQVQStNSWFLSVNIFVVVNM 319
40548805  238 DPMIFVESDSMVSPTHVVPEWYFLLTFTILRSVPDKLLVVVLMFSSVFVLAILIWPGAYYSILD-NFLYFFVMCFVWIFF 316
124286781 237 DPENFIKSNPMVSPIHIQPEWYFLQYYAILRAIPNKLGGVLFFVLALLALLMMPMFKFPGNLNMmMLWNLVVSFFLTVNL 316
99878752  237 DPDNFIKSNSMVSPIHIKPEWYFLQYYAILRSIPSKLGGIICFIMSVLILFMLIFLKNKQNLFSfKVVLMSWSWYVVLNL 316
119655312 238 DPENFIMANSLVSPIHIQPEWYFLQYYAILRAIPSKVGGVIIFVLSLVMIASMILFKNLNSCYT-KMNLFMMLVFMIVNI 316
119360185 242 DPENFILANSMISPIHIQPEWYFLQYYAILRAIPSKLGGVILFFLSLLSIFLMVYMNCLVLNFN-KMVKSMNFNFILINI 320
5835448   238 DPMIFVESDSMASPAHVVPEWYFLFAFTILRSVPSKLLGVILMFSSVFVLTILIWPGSYRSILD-NFLYFFVMCFVWVFF 316
23395810  240 DPMIFVESDSMASPAHVVPEWYFLFAFTILRSVPNKLFGVVLMFGSIFVLLVFIWFNNYQAMMD-NILYFLSMCFVWVFF 318
162424487 245 DPENFIKSNPMISPIHIQPEWYFLQYYAILRAIPNKLGGVLFFLLSLILLMMMIFFNYSMMMNNmKLWNLMTIMFIMSNI 324
299828997 238 DPMIFVESDSMASPAHVVPEWYFLFAFTILRSVPDKLFGVILMFGSVFVLLLLIWPGGYLSLFD-NVLYFFSVFFVWVFF 316
99878588  320 MLMWLGGCPVEAPFLLLSKIFTIMYFINPVMLFFLVK 356
40548805  317 WLTWAGYYPTDYPFNYFNLFCTFFYFCFIFFICLVNY 353
124286781 317 MLIWLGGLPVESPYLEISQVFTIIYFFWFMFLMLMKN 353
99878752  317 LLMWLGGCPVEYPFIFLSQILSALYFIYFMLFFMLVI 353
119655312 317 ILMWLGGQVVEEPYLTVSQFFSFLYFMWFLVLGIMMK 353
119360185 321 ILMWLGGKPVESPYLEISQILSLIYFLWFLMMSMLFK 357
5835448   317 WLTWAGHYPTDYPFNYFNLFCTFFYFCCIFFVCLINF 353
23395810  319 WLTWAGHYPTDYPFSYFNLICTIFYFIFIFFMCFVNF 355
162424487 325 ILVWLGGMPVEYPYLILSQILTFIYFLNFLLIYMFNY 361
299828997 317 WLTWAGHYPTDFPFNYFNLFATFFYFGCVFFMCFFNY 353
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap