Conserved Protein Domain Family
COX3

?
MTH00083: COX3 
cytochrome c oxidase subunit III; Provisional
Statistics
?
PSSM-Id: 177150
View PSSM: MTH00083
Aligned: 40 rows
Threshold Bit Score: 157.425
Threshold Setting Gi: 119360181
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
124286773   1 MFLLVTLQFNTGYSMWPLYTSISMFTLIFMFFMFLILn--KSVFFSFLLILISSAL--WFRDLVRESyFKGSQNMLMQTC 76 
5835449     4 KFRKYHKMEYSYYPLMVGVGILGFDVSLVLFMGMGMF---YSIFICFLYLVYVFFL--WIKDVILED-ISGQYSFYDYRM 77 
40548806    4 KFRKFHKMDYSYYPLMFSFGVFGVDVGLVLFMCLGMY---YPFFFCFLYLIYVSFL--WVKDLLLED-VSGQYSFYDYRI 77 
23395811    4 KFRKYHKMEFSYYPIMFGLGVLGIDFGLVLFMSMGIF---CSFFICLLYLLYVSFL--WMKDVFLED-VSGQYSFYDYRM 77 
119655311   1 MFLQFN----PKNSFWPVLLSIMMFYCFLSFINFMILknfFNLCTSIISLMLIIFM--WFKNLTTESiLLGGMNLFMQMN 74 
119637802   1 MFLQFN----PNNSYWPLFMSVILFFCFLSVINYFCFlsvINLLMSFIFMLILMLM--WFMNLYYEAkFLGSINLLMQMT 74 
119360181   1 MFLQFN-PNNSYLPLMMSMSIFFCFFNLINFFCFNLI----NFFNSFFFLLMIMLI--WFLNLFYESkYLGSMNLLMQMS 73 
99878587    4 QFNT----GASWYPLFMSMSIFISILSFFMFLNFKLL----TIWLSLIFFGLMSFM--WYRDLVRESlYVGSQNLLMILS 73 
110082722   1 ------MQYNTSNSLWPLYTSFSMFLLLLTFYYYLKT---TSALFDISYILLMINSkfWFGDLIRESfLKGTQNFLMQSS 71 
296863301   3 LYINYHLPHISYYPFMIFFYLMMFFSSVLVFLKNMIY---INFLLSFLMIFFLMII--WIKDIIVEG-ISGFHNFYVMEG 76 
124286773  77 LKLGMIFFILSEIFFFISFFWCYFHFMFMQSGELGFQWPSKGITAVNYLSVPLLNSLLLLSSGVSLTISHNLMsLDLKSF 156
5835449    78 FNQGFRLFLFSELTLFVSIFWTFLDTALCPLTWLSGVWSPLGILSPDYLGLNGMASLFLMMNSQVLKYSRRYLcLNSSKC 157
40548806   78 FAQGFRLFLFSELTLFFSIFRTFLDSALGPLTWLGGVWSPLGILSPDYLGLNGTASLFLMMNSQFLKYSRRYLcLNSCKC 157
23395811   78 FSQGFRLFLFSELTLFFSIFWTFLDSSLCPLTWLGGVWSPVGILSPDYLGINGMASLFLMMNSQVLKYSRRYLcLNVNKC 157
119655311  75 LKTGMIFFIISEIMFFFCFFWSYFHFMFLYSPEFGNCWPPVNINSLNYLSVPLLNTMLLLSSGLSITLSHTLLmMNNKNF 154
119637802  75 LKMGMIFFIMSEIMFFFSFFWSYFHFMFLHSGEFGGLWPPINIVKVNYLSVPLLNTMLLLSSGLSITVGHNLMlMNNLKT 154
119360181  74 VKMGMLFFIMSEMMFFFSFFWSYFHFMFMYALESGGMWPPINIPLVDYLSVPLLNTLLLLSSGLSITISHNFLmMNNSKM 153
99878587   74 IKLGMVFMILSEVFFFVSFFWTFMHFMFMYSGEMGYVWPPVNINSVNYMSIPLLNTLILLSSGCSLTISHMFLlMSSQQM 153
110082722  72 LKFGMIFFIVSEFFFFISFFWSYFHFMFMQSGEVGMEWPPKGVYAINCLSVPMLNSFLLLSSGVSLTVSHNMLlFEKKEF 151
296863301  77 FKMGLLLFLFSEFMFFFSIFWFFFDSSLVPLGDFGDNWVPLGMLLVNPFGMPFLNSLILLSSAVTLTWSHYSL-IMNNSS 155
124286773 157 NLYLGLTILLGLLFSYCQYWEYLMLDFLWSDSSYGSIFFMGTGFHGLHVIIGSTILSVILIRDMMNHLLMDSMI-FELGA 235
5835449   158 EEFLLVCIFIGVGFLCFQFYEYNNNSFVMSDSAYGSIFYMGTGLHGLHVFVGVCFLIVNFFRVKLFNFNWYHIQaYDMSI 237
40548806  158 ELFLLFCIFVGSGFLCFQFYEYSDNCFGMNDSIYGSIFYVGTGLHGFHVLVGVFFLMVNFFRIKLFNFNWYHIQaYDMSI 237
23395811  158 ENLLLLCIFIGSFFLCFQFFEYSHNCFVMNDSIYGSVFYIGTGLHGSHVLIGVCFLIVNFFRAKLHNFNWYHTQaYDMSI 237
119655311 155 KVYLLLTIMLGLIFMSFQFFEYYILEFNWSMSSYSSIFFMGTGFHGFHVTLGSIMLL--IIYILQNKMNLLSSs-YEMVA 231
119637802 155 GFYLLVTFILGLIFSFFQVLEYSFIEFNWSMSCYSSIFFMGTGFHGCHVLMGSFMIM--MLFMMKKNLNIFSSk-FEMIA 231
119360181 154 SYYLLLTLILGLVFSSFQLVEYYLLEFSWFMSCYSSIFFMGTGFHGCHVLIGSLMILFLFLMNKNMNILSSK---FEMIA 230
99878587  154 KSYLMYTIFLGLVFTFCQSWEYWMLDFLWSNSCFGSIFYMGTGFHGIHVIIGSLILIIVFSRSLSTSISSINNI-FELGS 232
110082722 152 KFLLLMTAILGVLFSYCQYWEYKMLDFLWSDSYYGSIFFLGTGFHGFHVIMGSLILLTIWFRSLYFQI-LTDSMmFELGA 230
296863301 156 LMSLFYTLLLGFYFLLIQMMEYKECFFTLSDSVFGTIFFFGTGFHGLHVFLGLLFLLFNYIRMSLFEFSSIHHLsYEFSI 235
124286773 236 WYWHFVDVIWIILFTEFYWWGK 257
5835449   238 DYWRFLEWMWGVMFCLLYVWGS 259
40548806  238 DYWRFLEWMWGIMFSLLYVWGS 259
23395811  238 DYWRFLEWMWGIMFCLLYVWGS 259
119655311 232 WYWHFVDMIWIILFTEFYWWV- 252
119637802 232 WYWHFVDMIWIILFTEFYWWV- 252
119360181 231 WYWHFVDMIWLILFMEFYWWVW 252
99878587  233 WYWHFVDVVWIFLFSEFYWFSF 254
110082722 231 WYWHFVDVIWMILFIEFYWWSK 252
296863301 236 LYWHFVDVVWLFLYVFFYYWYY 257
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap