Conserved Protein Domain Family
COX2

?
MTH00080: COX2 
cytochrome c oxidase subunit II; Provisional
Statistics
?
PSSM-Id: 177149
View PSSM: MTH00080
Aligned: 41 rows
Threshold Bit Score: 256.861
Threshold Setting Gi: 258649592
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
23395815    1 MYL--QNYVFPVPSNSYVFCCYF-IHNYYSHVIFFgfFIMFLVSFGLYFYGNSFKFNLKRSDSRMIELILQVLVVNFLVI 77 
110082721   3 NLLlaQYLGLNFMNQMSTEHY---LDLYNDLVIYLelIIACTVMIMILSIILNTWFQNVD-HWIVLESIWTMSPSIVLLI 78 
99878743    6 NFS--EYNCLNIMDLVYSLFGLD-LDNFNNLVLFLefMICTNVLGYIFFCSTNKFYIKAFSHSMSLEVTWTLIPVVVLIF 82 
99878586    3 KFS--QYLKLNLANQM--NLVSWeLDLYNDLVMLVelNTALSVFTYLSYVSSNKWYQKLN-HWGALELLWTLFPVSVLVV 77 
119360177   3 NFM-----GLNLMDQM--NFLNWkIYLYNDVVIFIesIIAFMVFSFMISMSLNKSWTQSMGHWFALELIWTISPVLILLF 75 
119637793   3 TYL-----GLNLLDQL--NFLNWkIYLYNDMVIFIesIVAFMVFMFMITTSYSKNWTQGMGHWFALELIWTVAPVLVLLF 75 
40548810    1 MYF--QNYIFPNPGSSYVYCCYY-IHNYYSHVIFFgfFLMLLVCIGVYFFGSSFKFNLKRSDSRMIELVLQVLIVNFLIM 77 
5835453     1 MYL--QNYVFPIPGNSYVFCCYY-IHNYYSHIIFFgfFVMFLVSGGIYFFGNSFKFNLKRSDSRMIELILQVLIVNFLIM 77 
124286782   4 NFS--QYWDFNIMNQLNSQFS---MDTFNDLVIYTelIIAFTVMIICMSIMFNFWFQNFK-HWIMLETIWTVTPVFVLLL 77 
299829002   1 MYL--QNYIFPLPGNMYVFCCYY-IHNYYSHIIFFgfFIMFLVSSGVFFCGNTFKFSLKRSDSRMIELVLQVLVVNFLIM 77 
23395815   78 MAGPGFWLIQYQGRMFRQSELTLKVIGHQWYWSYEYGDDSSLVFDSFMKPVDDL-SLGDFRLFDVDNRCVLPIGVNIGLY 156
110082721  79 LGIPSIKMIYSLEYTNFFSNLSIKIVGYQWYWNYSFPEF-EVEIDSYPKLMSDLfRMGESNLL------VLPIYTNLRLL 151
99878743   83 LGMPSLKILFLSEILMTKINISLKVTGYQWYWSYSFPEF-NISLMSYPNYLALFyRLAESDLL------ILPMSSSIQTL 155
99878586   78 LGCPSLKMLYMQELYQFSSNLSVKVLGYQWYWSYDFLEW-SVSLDSFPKMFSNLyRLGESELL------VLPVSFNIRLL 150
119360177  76 LGLPSLKMLYFSEIYNFSSYLSLKVMGHQWYWEYSFPEF-NTNILSFPKVLSELiRFGESILL------VLPFNFKIRAI 148
119637793  76 LGLPSLKLLYLSEIYNFKSDFSLKITGHQWYWEYNFPEF-NVSVLSFPKALSQLiRLGEANLL------TLPFNSKIRAI 148
40548810   78 MAGPGFWLIQYQGRMFRQSELTLKVIGHQWYWSYEYGDSGKLCFDSFMKSLDDL-SLGDYRLFEVDNRCVLPVGVNVGIY 156
5835453    78 MAGPGFWLIQYQGRMFRQSELTLKVIGHQWYWSYEYGDSGKLCFDSFMKSLDDL-SLGDFRLFDVDNRCVLPVGVNVGVY 156
124286782  78 LGFPSIKMVYSMELTNFFSNLTLKIMGFQWYWNYSFPEY-EIQFDSYPKMISELfRLGESDLL------VLPILVNIRFL 150
299829002  78 MAGPGFWLIQYQGRMFRQSELSLKVIGHQWYWSYEYGNSGGLCFDSFMKPIDDL-SLGDFRLLDVDNRCVLPVGVNVGIY 156
23395815  157 CTSSDVIHSFAVPKCFVKMDALNGLLTKITFNFSCCGLFYGQCSEICGANHSFMPIALELTSLECWKAWSLGYLL 231
110082721 152 MTSNDVIHSWALPSISLKMDAVPGRLNMLSTKILSIGNYMGQCSELCGNYHSWMPIYAESTNSIIFNQWIKLLFT 226
99878743  156 ITSQDVIHSWALPSLGFKMDACPGRLNYYVLSSNLPSLHIGQCSELCGSYHSWMPIMVEFTSCSLFIEWLKNIL- 229
99878586  151 ISSEDVIHSWTIPSLGVKMDATPGRLNFINILNNQPSKFIGQCSELCGNFHSWMPIYVEFSSTNIFIEWCKIYKI 225
119360177 149 ISSSDVIHSWALPSMSFKMDAIPGRLNFYMMMFMMPGKFIGQCSELCGTYHSWMPIYIETTSISLFFEWMKSI-- 221
119637793 149 ISSSDVIHSWALPSMGFKMDAIPGRLNFYMMMFSIPGKFMGQCSELCGSYHSWMPIFIETTSMSLFFEWMKNL-- 221
40548810  157 CTSSDVIHSFAVPKCFVKMDALNGLLTKITCNFSCSGLFYGQCSEICGANHSFMPIVLELTSMECWKGWCVNFLL 231
5835453   157 CTSSDVIHSFAIPKCFIKMDALNGLLTKVTCSFSCSGLFFGQCSEICGANHSFMPIVLELTSLECWKGWSVNYLL 231
124286782 151 TSSNDVIHSWTLPSLSMKMDAIPGRLNLLSSQISFIGKHIGQCSELCGNYHSWMPIYVESASMKIFTEWMKVF-- 223
299829002 157 CTSSDVIHSFAIPKCFIKIDALNGLLTKITYRFSCSGLFYGQCSEICGANHSFMPIVVESTSLECWKGWSLSYLL 231
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap